Detailed information NTG0611389

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LE189_RS10925
• Genome accession: NZ_CP084444
• Coordinates: 2256938..2257252 (+)
• Length: 104 a.a.
• NCBI ID: WP_002459016.1
• Uniprot ID: -
• Organism: Staphylococcus lugdunensis strain RMLUG6
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2251938..2262252

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LE189_RS10895 (LE189_10885)	-	2252730..2252933 (+)	204	WP_002459010.1	YqgQ family protein	-
LE189_RS10900 (LE189_10890)	-	2252930..2253916 (+)	987	WP_002491907.1	ROK family glucokinase	-
LE189_RS10905 (LE189_10895)	-	2253916..2254239 (+)	324	WP_002459012.1	MTH1187 family thiamine-binding protein	-
LE189_RS10910 (LE189_10900)	-	2254243..2254866 (+)	624	WP_002459013.1	MBL fold metallo-hydrolase	-
LE189_RS10915 (LE189_10905)	comGA	2254913..2255887 (+)	975	WP_002491905.1	competence type IV pilus ATPase ComGA	Machinery gene
LE189_RS10920 (LE189_10910)	comGB	2255859..2256923 (+)	1065	WP_002478130.1	competence type IV pilus assembly protein ComGB	-
LE189_RS10925 (LE189_10915)	comGC	2256938..2257252 (+)	315	WP_002459016.1	competence type IV pilus major pilin ComGC	Machinery gene
LE189_RS10930 (LE189_10920)	comGD	2257185..2257679 (+)	495	WP_225306455.1	competence type IV pilus minor pilin ComGD	-
LE189_RS10935 (LE189_10925)	-	2257666..2257959 (+)	294	WP_002459018.1	hypothetical protein	-
LE189_RS10940 (LE189_10930)	-	2258021..2258380 (+)	360	WP_002459019.1	competence type IV pilus minor pilin ComGF	-
LE189_RS10945 (LE189_10935)	-	2258534..2259052 (+)	519	WP_002459021.1	shikimate kinase	-
LE189_RS10950 (LE189_10940)	gcvT	2259222..2260313 (+)	1092	WP_037540763.1	glycine cleavage system aminomethyltransferase GcvT	-
LE189_RS10955 (LE189_10945)	gcvPA	2260330..2261679 (+)	1350	WP_002478134.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11373.37 Da
• Isoelectric Point: 8.2727

>NTDB_id=611389 LE189_RS10925 WP_002459016.1 2256938..2257252(+) (comGC) [Staphylococcus lugdunensis strain RMLUG6]
MKFSFYKKCKAFTLIEMLLVLLIISVLLILIIPNIAKQTAHVQSTGCEAQVKMVNSQIEAYTLKHNGSPKSIDDLISEGF
IKDGQKNCKSGETISISNGEAVAN

Nucleotide

• Length: 315 bp

>NTDB_id=611389 LE189_RS10925 WP_002459016.1 2256938..2257252(+) (comGC) [Staphylococcus lugdunensis strain RMLUG6]
ATGAAATTTTCTTTTTATAAAAAATGCAAAGCGTTTACACTAATAGAAATGTTATTAGTATTACTAATTATTAGTGTCTT
GCTTATCTTAATTATTCCAAACATTGCCAAACAAACAGCACATGTACAATCAACAGGTTGTGAAGCACAAGTAAAGATGG
TCAATAGCCAAATAGAAGCCTATACTCTAAAGCATAATGGATCTCCAAAAAGCATTGATGATTTAATTTCTGAGGGTTTT
ATTAAAGATGGTCAAAAGAATTGCAAATCTGGGGAAACCATCAGCATATCAAATGGTGAGGCAGTTGCAAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (7-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	82.353	98.077	0.808
comGC	Staphylococcus aureus N315	82.353	98.077	0.808
comYC	Streptococcus gordonii str. Challis substr. CH1	45.918	94.231	0.433
comGC/cglC	Streptococcus pneumoniae TIGR4	44.554	97.115	0.433
comGC	Bacillus subtilis subsp. subtilis str. 168	46.154	87.5	0.404
comGC/cglC	Streptococcus pneumoniae R6	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae Rx1	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae D39	48.235	81.731	0.394
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	75.962	0.385
comGC/cglC	Streptococcus mitis SK321	51.282	75	0.385
comGC/cglC	Streptococcus mitis NCTC 12261	51.282	75	0.385
comYC	Streptococcus mutans UA140	48.75	76.923	0.375
comYC	Streptococcus mutans UA159	48.75	76.923	0.375