Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   BASU_RS11650 Genome accession   NC_022081
Coordinates   2413424..2413801 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis UCMB5113     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2408424..2418801
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BASU_RS11610 (BASU_2216) - 2408922..2409716 (+) 795 WP_007408330.1 YqhG family protein -
  BASU_RS11615 (BASU_2217) sinI 2409893..2410066 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  BASU_RS11620 (BASU_2218) sinR 2410100..2410435 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BASU_RS11625 (BASU_2219) - 2410483..2411268 (-) 786 WP_007408329.1 TasA family protein -
  BASU_RS11630 (BASU_2220) - 2411333..2411917 (-) 585 WP_015240205.1 signal peptidase I -
  BASU_RS11635 (BASU_2221) tapA 2411889..2412560 (-) 672 WP_020956077.1 amyloid fiber anchoring/assembly protein TapA -
  BASU_RS11640 (BASU_2223) - 2412819..2413148 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  BASU_RS11645 (BASU_2224) - 2413188..2413367 (-) 180 WP_003153093.1 YqzE family protein -
  BASU_RS11650 (BASU_2225) comGG 2413424..2413801 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  BASU_RS11655 (BASU_2226) comGF 2413802..2414302 (-) 501 WP_260485564.1 competence type IV pilus minor pilin ComGF -
  BASU_RS11660 (BASU_2227) comGE 2414211..2414525 (-) 315 WP_041482453.1 competence type IV pilus minor pilin ComGE -
  BASU_RS11665 (BASU_2228) comGD 2414509..2414946 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  BASU_RS11670 (BASU_2229) comGC 2414936..2415202 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  BASU_RS11675 (BASU_2230) comGB 2415249..2416286 (-) 1038 WP_020956080.1 competence type IV pilus assembly protein ComGB Machinery gene
  BASU_RS11680 (BASU_2231) comGA 2416273..2417343 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  BASU_RS11685 (BASU_2232) - 2417535..2418485 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=61117 BASU_RS11650 WP_015417814.1 2413424..2413801(-) (comGG) [Bacillus velezensis UCMB5113]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=61117 BASU_RS11650 WP_015417814.1 2413424..2413801(-) (comGG) [Bacillus velezensis UCMB5113]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGGCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment