Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BASU_RS11615 Genome accession   NC_022081
Coordinates   2409893..2410066 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis UCMB5113     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2404893..2415066
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BASU_RS11600 (BASU_2214) gcvT 2405706..2406806 (-) 1101 WP_020956076.1 glycine cleavage system aminomethyltransferase GcvT -
  BASU_RS11605 (BASU_2215) - 2407230..2408900 (+) 1671 WP_007408331.1 SNF2-related protein -
  BASU_RS11610 (BASU_2216) - 2408922..2409716 (+) 795 WP_007408330.1 YqhG family protein -
  BASU_RS11615 (BASU_2217) sinI 2409893..2410066 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  BASU_RS11620 (BASU_2218) sinR 2410100..2410435 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BASU_RS11625 (BASU_2219) - 2410483..2411268 (-) 786 WP_007408329.1 TasA family protein -
  BASU_RS11630 (BASU_2220) - 2411333..2411917 (-) 585 WP_015240205.1 signal peptidase I -
  BASU_RS11635 (BASU_2221) tapA 2411889..2412560 (-) 672 WP_020956077.1 amyloid fiber anchoring/assembly protein TapA -
  BASU_RS11640 (BASU_2223) - 2412819..2413148 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  BASU_RS11645 (BASU_2224) - 2413188..2413367 (-) 180 WP_003153093.1 YqzE family protein -
  BASU_RS11650 (BASU_2225) comGG 2413424..2413801 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  BASU_RS11655 (BASU_2226) comGF 2413802..2414302 (-) 501 WP_260485564.1 competence type IV pilus minor pilin ComGF -
  BASU_RS11660 (BASU_2227) comGE 2414211..2414525 (-) 315 WP_041482453.1 competence type IV pilus minor pilin ComGE -
  BASU_RS11665 (BASU_2228) comGD 2414509..2414946 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=61115 BASU_RS11615 WP_003153105.1 2409893..2410066(+) (sinI) [Bacillus velezensis UCMB5113]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=61115 BASU_RS11615 WP_003153105.1 2409893..2410066(+) (sinI) [Bacillus velezensis UCMB5113]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment