Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BASU_RS11615 | Genome accession | NC_022081 |
| Coordinates | 2409893..2410066 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis UCMB5113 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2404893..2415066
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BASU_RS11600 (BASU_2214) | gcvT | 2405706..2406806 (-) | 1101 | WP_020956076.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BASU_RS11605 (BASU_2215) | - | 2407230..2408900 (+) | 1671 | WP_007408331.1 | SNF2-related protein | - |
| BASU_RS11610 (BASU_2216) | - | 2408922..2409716 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| BASU_RS11615 (BASU_2217) | sinI | 2409893..2410066 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| BASU_RS11620 (BASU_2218) | sinR | 2410100..2410435 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BASU_RS11625 (BASU_2219) | - | 2410483..2411268 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| BASU_RS11630 (BASU_2220) | - | 2411333..2411917 (-) | 585 | WP_015240205.1 | signal peptidase I | - |
| BASU_RS11635 (BASU_2221) | tapA | 2411889..2412560 (-) | 672 | WP_020956077.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BASU_RS11640 (BASU_2223) | - | 2412819..2413148 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| BASU_RS11645 (BASU_2224) | - | 2413188..2413367 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BASU_RS11650 (BASU_2225) | comGG | 2413424..2413801 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BASU_RS11655 (BASU_2226) | comGF | 2413802..2414302 (-) | 501 | WP_260485564.1 | competence type IV pilus minor pilin ComGF | - |
| BASU_RS11660 (BASU_2227) | comGE | 2414211..2414525 (-) | 315 | WP_041482453.1 | competence type IV pilus minor pilin ComGE | - |
| BASU_RS11665 (BASU_2228) | comGD | 2414509..2414946 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=61115 BASU_RS11615 WP_003153105.1 2409893..2410066(+) (sinI) [Bacillus velezensis UCMB5113]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=61115 BASU_RS11615 WP_003153105.1 2409893..2410066(+) (sinI) [Bacillus velezensis UCMB5113]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |