Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   NMT99_RS12420 Genome accession   NZ_CP101290
Coordinates   2417384..2417767 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain LjM2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2412384..2422767
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NMT99_RS12380 sinI 2413318..2413491 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NMT99_RS12385 sinR 2413525..2413860 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NMT99_RS12390 tasA 2413953..2414738 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  NMT99_RS12395 sipW 2414802..2415374 (-) 573 WP_072692741.1 signal peptidase I SipW -
  NMT99_RS12400 tapA 2415358..2416119 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  NMT99_RS12405 yqzG 2416390..2416716 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NMT99_RS12410 spoIITA 2416758..2416937 (-) 180 WP_029726723.1 YqzE family protein -
  NMT99_RS12415 comGG 2417009..2417383 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  NMT99_RS12420 comGF 2417384..2417767 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  NMT99_RS12425 comGE 2417793..2418140 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  NMT99_RS12430 comGD 2418124..2418555 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  NMT99_RS12435 comGC 2418545..2418841 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  NMT99_RS12440 comGB 2418855..2419892 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  NMT99_RS12445 comGA 2419879..2420949 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  NMT99_RS12450 - 2421162..2421359 (-) 198 WP_029726717.1 hypothetical protein -
  NMT99_RS12455 corA 2421361..2422314 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=610019 NMT99_RS12420 WP_029726721.1 2417384..2417767(-) (comGF) [Bacillus subtilis strain LjM2]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=610019 NMT99_RS12420 WP_029726721.1 2417384..2417767(-) (comGF) [Bacillus subtilis strain LjM2]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969