Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   LAZ98_RS02025 Genome accession   NZ_CP083764
Coordinates   400477..400596 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain DMB07     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 395477..405596
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LAZ98_RS02010 (LAZ98_02010) - 397089..397772 (+) 684 WP_014416901.1 response regulator transcription factor -
  LAZ98_RS02015 (LAZ98_02015) - 397759..399186 (+) 1428 WP_106067998.1 HAMP domain-containing sensor histidine kinase -
  LAZ98_RS02020 (LAZ98_02020) rapC 399345..400493 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  LAZ98_RS02025 (LAZ98_02025) phrC 400477..400596 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  LAZ98_RS02030 (LAZ98_02030) - 400746..400856 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  LAZ98_RS02035 (LAZ98_02035) - 400936..402300 (-) 1365 WP_017419273.1 aspartate kinase -
  LAZ98_RS02040 (LAZ98_02040) ceuB 402714..403667 (+) 954 WP_014416904.1 ABC transporter permease Machinery gene
  LAZ98_RS02045 (LAZ98_02045) - 403657..404604 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  LAZ98_RS02050 (LAZ98_02050) - 404598..405356 (+) 759 WP_022552588.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=607799 LAZ98_RS02025 WP_003156334.1 400477..400596(+) (phrC) [Bacillus velezensis strain DMB07]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=607799 LAZ98_RS02025 WP_003156334.1 400477..400596(+) (phrC) [Bacillus velezensis strain DMB07]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718