Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | LAZ97_RS12540 | Genome accession | NZ_CP083763 |
| Coordinates | 2564417..2564590 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain DMB06 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2559417..2569590
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LAZ97_RS12525 (LAZ97_12525) | gcvT | 2560230..2561330 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| LAZ97_RS12530 (LAZ97_12530) | - | 2561754..2563424 (+) | 1671 | WP_017418135.1 | DEAD/DEAH box helicase | - |
| LAZ97_RS12535 (LAZ97_12535) | - | 2563446..2564240 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| LAZ97_RS12540 (LAZ97_12540) | sinI | 2564417..2564590 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| LAZ97_RS12545 (LAZ97_12545) | sinR | 2564624..2564959 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| LAZ97_RS12550 (LAZ97_12550) | tasA | 2565007..2565792 (-) | 786 | WP_017418136.1 | biofilm matrix protein TasA | - |
| LAZ97_RS12555 (LAZ97_12555) | sipW | 2565857..2566441 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| LAZ97_RS12560 (LAZ97_12560) | tapA | 2566413..2567084 (-) | 672 | WP_025649852.1 | amyloid fiber anchoring/assembly protein TapA | - |
| LAZ97_RS12565 (LAZ97_12565) | - | 2567343..2567672 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| LAZ97_RS12570 (LAZ97_12570) | - | 2567713..2567892 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| LAZ97_RS12575 (LAZ97_12575) | comGG | 2567949..2568326 (-) | 378 | WP_025649851.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LAZ97_RS12580 (LAZ97_12580) | comGF | 2568327..2568722 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| LAZ97_RS12585 (LAZ97_12585) | comGE | 2568736..2569050 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LAZ97_RS12590 (LAZ97_12590) | comGD | 2569034..2569471 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=607753 LAZ97_RS12540 WP_014418369.1 2564417..2564590(+) (sinI) [Bacillus velezensis strain DMB06]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=607753 LAZ97_RS12540 WP_014418369.1 2564417..2564590(+) (sinI) [Bacillus velezensis strain DMB06]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |