Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LAZ97_RS12540 Genome accession   NZ_CP083763
Coordinates   2564417..2564590 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain DMB06     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2559417..2569590
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LAZ97_RS12525 (LAZ97_12525) gcvT 2560230..2561330 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  LAZ97_RS12530 (LAZ97_12530) - 2561754..2563424 (+) 1671 WP_017418135.1 DEAD/DEAH box helicase -
  LAZ97_RS12535 (LAZ97_12535) - 2563446..2564240 (+) 795 WP_014305407.1 YqhG family protein -
  LAZ97_RS12540 (LAZ97_12540) sinI 2564417..2564590 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  LAZ97_RS12545 (LAZ97_12545) sinR 2564624..2564959 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LAZ97_RS12550 (LAZ97_12550) tasA 2565007..2565792 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  LAZ97_RS12555 (LAZ97_12555) sipW 2565857..2566441 (-) 585 WP_012117977.1 signal peptidase I SipW -
  LAZ97_RS12560 (LAZ97_12560) tapA 2566413..2567084 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  LAZ97_RS12565 (LAZ97_12565) - 2567343..2567672 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  LAZ97_RS12570 (LAZ97_12570) - 2567713..2567892 (-) 180 WP_003153093.1 YqzE family protein -
  LAZ97_RS12575 (LAZ97_12575) comGG 2567949..2568326 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  LAZ97_RS12580 (LAZ97_12580) comGF 2568327..2568722 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  LAZ97_RS12585 (LAZ97_12585) comGE 2568736..2569050 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  LAZ97_RS12590 (LAZ97_12590) comGD 2569034..2569471 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=607753 LAZ97_RS12540 WP_014418369.1 2564417..2564590(+) (sinI) [Bacillus velezensis strain DMB06]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=607753 LAZ97_RS12540 WP_014418369.1 2564417..2564590(+) (sinI) [Bacillus velezensis strain DMB06]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719