Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   LAZ97_RS12585 Genome accession   NZ_CP083763
Coordinates   2568736..2569050 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain DMB06     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2563736..2574050
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LAZ97_RS12540 (LAZ97_12540) sinI 2564417..2564590 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  LAZ97_RS12545 (LAZ97_12545) sinR 2564624..2564959 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LAZ97_RS12550 (LAZ97_12550) tasA 2565007..2565792 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  LAZ97_RS12555 (LAZ97_12555) sipW 2565857..2566441 (-) 585 WP_012117977.1 signal peptidase I SipW -
  LAZ97_RS12560 (LAZ97_12560) tapA 2566413..2567084 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  LAZ97_RS12565 (LAZ97_12565) - 2567343..2567672 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  LAZ97_RS12570 (LAZ97_12570) - 2567713..2567892 (-) 180 WP_003153093.1 YqzE family protein -
  LAZ97_RS12575 (LAZ97_12575) comGG 2567949..2568326 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  LAZ97_RS12580 (LAZ97_12580) comGF 2568327..2568722 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  LAZ97_RS12585 (LAZ97_12585) comGE 2568736..2569050 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  LAZ97_RS12590 (LAZ97_12590) comGD 2569034..2569471 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  LAZ97_RS12595 (LAZ97_12595) comGC 2569461..2569769 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  LAZ97_RS12600 (LAZ97_12600) comGB 2569774..2570811 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  LAZ97_RS12605 (LAZ97_12605) comGA 2570798..2571868 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  LAZ97_RS12610 (LAZ97_12610) - 2572061..2573013 (-) 953 Protein_2442 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=607756 LAZ97_RS12585 WP_017418140.1 2568736..2569050(-) (comGE) [Bacillus velezensis strain DMB06]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=607756 LAZ97_RS12585 WP_017418140.1 2568736..2569050(-) (comGE) [Bacillus velezensis strain DMB06]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481