Detailed information    

insolico Bioinformatically predicted

Overview


Name   CJE0566   Type   Regulator
Locus tag   LAE75_RS01000 Genome accession   NZ_CP083378
Coordinates   165810..166463 (+) Length   217 a.a.
NCBI ID   WP_224027415.1    Uniprot ID   -
Organism   Campylobacter coli strain C203112     
Function   repress natural transformation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 145243..184368 165810..166463 within 0


Gene organization within MGE regions


Location: 145243..184368
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LAE75_RS00870 (LAE75_00830) legB 145243..146205 (-) 963 WP_224027467.1 4,6-dehydratase LegB -
  LAE75_RS00875 (LAE75_00835) - 146205..146426 (-) 222 Protein_164 flagellin -
  LAE75_RS00880 - 146523..146696 (-) 174 Protein_165 hypothetical protein -
  LAE75_RS00885 (LAE75_00845) - 147165..148826 (-) 1662 WP_224027408.1 hypothetical protein -
  LAE75_RS00890 (LAE75_00850) - 148829..149023 (-) 195 WP_002782214.1 hypothetical protein -
  LAE75_RS00895 (LAE75_00855) - 149004..149408 (-) 405 WP_002796938.1 hypothetical protein -
  LAE75_RS00900 (LAE75_00860) - 149408..150442 (-) 1035 WP_224027409.1 DUF5309 family protein -
  LAE75_RS00905 (LAE75_00865) - 150714..151214 (+) 501 WP_060789942.1 hypothetical protein -
  LAE75_RS00910 (LAE75_00870) - 151201..151512 (+) 312 WP_060789941.1 hypothetical protein -
  LAE75_RS00915 - 151787..152032 (-) 246 WP_002810242.1 hypothetical protein -
  LAE75_RS00920 (LAE75_00875) - 152194..155511 (-) 3318 WP_224027410.1 hypothetical protein -
  LAE75_RS00925 - 155524..156567 (-) 1044 WP_224027411.1 hypothetical protein -
  LAE75_RS00930 (LAE75_00885) - 156827..157207 (-) 381 WP_032582824.1 hypothetical protein -
  LAE75_RS00935 (LAE75_00890) - 157218..157865 (-) 648 WP_002784021.1 hypothetical protein -
  LAE75_RS00940 (LAE75_00895) - 157855..158058 (-) 204 WP_052780024.1 hypothetical protein -
  LAE75_RS00945 (LAE75_00900) - 158051..159589 (-) 1539 WP_060794082.1 hypothetical protein -
  LAE75_RS00950 (LAE75_00905) - 159570..159842 (-) 273 WP_002781524.1 hypothetical protein -
  LAE75_RS00955 (LAE75_00910) - 159832..161124 (-) 1293 WP_052795874.1 terminase large subunit domain-containing protein -
  LAE75_RS00960 (LAE75_00915) - 161121..161507 (-) 387 WP_002825868.1 terminase small subunit -
  LAE75_RS00965 (LAE75_00920) - 161507..161887 (-) 381 WP_002788333.1 hypothetical protein -
  LAE75_RS00970 (LAE75_00925) - 162057..162557 (-) 501 WP_224027412.1 hypothetical protein -
  LAE75_RS00975 (LAE75_00930) - 162568..163569 (-) 1002 WP_224027413.1 hypothetical protein -
  LAE75_RS00980 (LAE75_00935) - 163566..163865 (-) 300 WP_002861657.1 hypothetical protein -
  LAE75_RS00985 (LAE75_00940) - 163971..164204 (-) 234 WP_072235911.1 hypothetical protein -
  LAE75_RS00990 (LAE75_00945) - 164315..164986 (+) 672 WP_052780014.1 LexA family transcriptional regulator -
  LAE75_RS00995 (LAE75_00950) - 165017..165790 (+) 774 WP_224027414.1 hypothetical protein -
  LAE75_RS01000 (LAE75_00955) CJE0566 165810..166463 (+) 654 WP_224027415.1 DNA/RNA non-specific endonuclease Regulator
  LAE75_RS01005 (LAE75_00960) - 166491..167321 (+) 831 WP_032582836.1 DNA-processing protein DprA -
  LAE75_RS01010 (LAE75_00965) - 167318..167920 (+) 603 WP_032582837.1 phosphoribosyltransferase -
  LAE75_RS01015 (LAE75_00970) - 167947..168717 (-) 771 WP_139884813.1 SEL1-like repeat protein -
  LAE75_RS01020 - 168721..169413 (-) 693 WP_223207056.1 hypothetical protein -
  LAE75_RS01025 (LAE75_00980) - 169566..169838 (+) 273 WP_002783985.1 hypothetical protein -
  LAE75_RS01030 (LAE75_00985) - 170420..170689 (+) 270 WP_002783984.1 hypothetical protein -
  LAE75_RS01035 (LAE75_00990) - 170680..170934 (+) 255 WP_057993461.1 hypothetical protein -
  LAE75_RS01040 (LAE75_00995) - 170931..171083 (+) 153 WP_002795985.1 hypothetical protein -
  LAE75_RS01045 (LAE75_01000) - 171076..171273 (-) 198 WP_002810107.1 hypothetical protein -
  LAE75_RS01050 (LAE75_01005) - 171416..171598 (+) 183 WP_052773987.1 hypothetical protein -
  LAE75_RS01055 - 171595..172359 (+) 765 WP_072224827.1 phage antirepressor KilAC domain-containing protein -
  LAE75_RS01060 (LAE75_01020) - 172349..173203 (+) 855 WP_139884808.1 lambda exonuclease family protein -
  LAE75_RS01065 (LAE75_01025) - 173205..173939 (+) 735 WP_057038120.1 hypothetical protein -
  LAE75_RS01070 (LAE75_01030) - 173939..174634 (+) 696 WP_002783960.1 hypothetical protein -
  LAE75_RS01075 (LAE75_01035) - 174615..174893 (+) 279 WP_224027468.1 hypothetical protein -
  LAE75_RS01080 (LAE75_01040) - 174874..175626 (+) 753 WP_224027416.1 site-specific DNA-methyltransferase -
  LAE75_RS01085 (LAE75_01045) - 175662..175955 (+) 294 WP_002873572.1 hypothetical protein -
  LAE75_RS01090 (LAE75_01050) - 175965..176198 (+) 234 WP_002782536.1 hypothetical protein -
  LAE75_RS01095 (LAE75_01055) - 176195..176572 (+) 378 WP_002782538.1 hypothetical protein -
  LAE75_RS01100 (LAE75_01065) - 176721..176966 (+) 246 WP_070234833.1 hypothetical protein -
  LAE75_RS01105 (LAE75_01070) - 177008..177163 (+) 156 WP_002826691.1 hypothetical protein -
  LAE75_RS01110 (LAE75_01075) - 177310..177990 (+) 681 WP_224027417.1 antA/AntB antirepressor family protein -
  LAE75_RS01115 (LAE75_01080) - 177995..178414 (+) 420 WP_060787578.1 YopX family protein -
  LAE75_RS01120 (LAE75_01085) - 178401..178805 (+) 405 WP_002811738.1 hypothetical protein -
  LAE75_RS01125 (LAE75_01090) - 178849..179391 (+) 543 WP_060787577.1 pentapeptide repeat-containing protein -
  LAE75_RS09065 (LAE75_01095) - 179384..179623 (+) 240 WP_002811742.1 helix-turn-helix domain-containing protein -
  LAE75_RS01135 (LAE75_01100) - 179550..180749 (-) 1200 WP_002783946.1 site-specific integrase -
  LAE75_RS01145 (LAE75_01110) - 181089..181427 (-) 339 WP_002785015.1 F0F1 ATP synthase subunit C -
  LAE75_RS01150 (LAE75_01115) - 181671..183005 (+) 1335 WP_002785017.1 sodium-dependent transporter -
  LAE75_RS01155 (LAE75_01120) - 183019..184368 (+) 1350 WP_002790562.1 sodium-dependent transporter -

Sequence


Protein


Download         Length: 217 a.a.        Molecular weight: 25551.18 Da        Isoelectric Point: 9.7849

>NTDB_id=605483 LAE75_RS01000 WP_224027415.1 165810..166463(+) (CJE0566) [Campylobacter coli strain C203112]
MKKLILLPLLSTLAFADYTQYKPSEEFAKYFTKQSCSQVLDKFYYLNCYDYNLKGTKAVAYRLEADNLKGEQIKKRPRFE
DDTNIPKKYRTTWSDYKNSGYDRGHTISNASMRKTTQAQRSTFLMSNITPQNPQINQKVWNKIEKRERQVALKLGEIEVL
NLVNYDSNPQRIRNQIAIPSSYIKILKGENFKECYQVPNHEVEDESIKKYKVNCDKI

Nucleotide


Download         Length: 654 bp        

>NTDB_id=605483 LAE75_RS01000 WP_224027415.1 165810..166463(+) (CJE0566) [Campylobacter coli strain C203112]
GTGAAAAAACTCATACTTTTACCATTGTTATCCACTCTAGCTTTTGCTGACTATACGCAATATAAACCAAGCGAAGAGTT
TGCTAAGTATTTTACTAAGCAAAGTTGTTCGCAAGTTTTAGATAAATTCTATTATCTAAATTGCTATGATTATAATCTAA
AAGGCACTAAAGCCGTAGCTTATAGATTAGAAGCGGATAATTTAAAAGGTGAACAAATCAAAAAACGCCCACGCTTTGAA
GATGATACAAATATACCTAAAAAATACCGCACTACATGGAGTGATTATAAAAACAGCGGTTATGATAGAGGGCATACTAT
TTCTAATGCTTCAATGAGAAAAACAACTCAAGCTCAAAGAAGCACTTTCTTAATGAGTAATATTACTCCACAAAATCCAC
AAATTAATCAAAAAGTATGGAATAAGATTGAAAAAAGAGAAAGACAAGTAGCTTTAAAGCTTGGAGAAATTGAAGTTTTA
AATTTGGTTAATTATGATAGCAACCCTCAAAGAATAAGAAATCAAATTGCTATTCCAAGCTCTTATATTAAAATCTTAAA
AGGTGAGAATTTTAAAGAATGTTACCAAGTACCAAATCATGAAGTTGAAGATGAGAGTATAAAAAAATATAAGGTTAATT
GTGATAAAATATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  CJE0566 Campylobacter jejuni RM1221

94.47

100

0.945

  CJE1441 Campylobacter jejuni RM1221

89.767

99.078

0.889