Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   K8Z53_RS02265 Genome accession   NZ_CP083238
Coordinates   401433..401609 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain 2709     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 396433..406609
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K8Z53_RS02250 (K8Z53_02225) gcvT 397076..398170 (-) 1095 WP_073425739.1 glycine cleavage system aminomethyltransferase GcvT -
  K8Z53_RS02255 (K8Z53_02230) - 398762..400441 (+) 1680 WP_142782882.1 DEAD/DEAH box helicase -
  K8Z53_RS02260 (K8Z53_02235) - 400448..401242 (+) 795 WP_003183441.1 YqhG family protein -
  K8Z53_RS02265 (K8Z53_02240) sinI 401433..401609 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  K8Z53_RS02270 (K8Z53_02245) sinR 401643..401978 (+) 336 WP_006637528.1 transcriptional regulator SinR Regulator
  K8Z53_RS02275 (K8Z53_02250) tasA 402083..402877 (-) 795 WP_142782737.1 biofilm matrix protein TasA -
  K8Z53_RS02280 (K8Z53_02255) sipW 402951..403535 (-) 585 WP_003183449.1 signal peptidase I SipW -
  K8Z53_RS02285 (K8Z53_02260) tapA 403532..404260 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  K8Z53_RS02290 (K8Z53_02265) - 404537..404857 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  K8Z53_RS02295 (K8Z53_02270) - 404881..405063 (-) 183 WP_003183456.1 YqzE family protein -
  K8Z53_RS02300 (K8Z53_02275) comGG 405151..405516 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  K8Z53_RS02305 (K8Z53_02280) comGF 405529..406017 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  K8Z53_RS02310 (K8Z53_02285) comGE 405926..406273 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=605057 K8Z53_RS02265 WP_003183444.1 401433..401609(+) (sinI) [Bacillus licheniformis strain 2709]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=605057 K8Z53_RS02265 WP_003183444.1 401433..401609(+) (sinI) [Bacillus licheniformis strain 2709]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517