NTDB

Overview

Name	comGF	Type	Machinery gene
Locus tag	K8B78_RS07490	Genome accession	NZ_CP082815
Coordinates	1593738..1594235 (-)	Length	165 a.a.
NCBI ID	WP_001794055.1	Uniprot ID	A0A7U7EV69
Organism	Staphylococcus aureus strain SCAID WND1-2021 (598)
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1588738..1599235

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
K8B78_RS07465 (K8B78_07465)	gcvPB	1588900..1590372 (-)	1473	WP_000202178.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPB	-
K8B78_RS07470 (K8B78_07470)	gcvPA	1590365..1591711 (-)	1347	WP_000019697.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
K8B78_RS07475 (K8B78_07475)	gcvT	1591731..1592822 (-)	1092	WP_000093347.1	glycine cleavage system aminomethyltransferase GcvT	-
K8B78_RS07480 (K8B78_07480)	-	1592981..1593505 (-)	525	WP_001015125.1	shikimate kinase	-
K8B78_RS07485 (K8B78_07485)	-	1593495..1593641 (-)	147	WP_001789879.1	hypothetical protein	-
K8B78_RS07490 (K8B78_07490)	comGF	1593738..1594235 (-)	498	WP_001794055.1	competence type IV pilus minor pilin ComGF	Machinery gene
K8B78_RS07495 (K8B78_07495)	comGE	1594153..1594452 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
K8B78_RS07500 (K8B78_07500)	comGD	1594439..1594885 (-)	447	WP_001791207.1	competence type IV pilus minor pilin ComGD	Machinery gene
K8B78_RS07505 (K8B78_07505)	comGC	1594863..1595174 (-)	312	WP_000472257.1	competence type IV pilus major pilin ComGC	Machinery gene
K8B78_RS07510 (K8B78_07510)	comGB	1595188..1596258 (-)	1071	WP_000776412.1	competence type IV pilus assembly protein ComGB	Machinery gene
K8B78_RS07515 (K8B78_07515)	comGA	1596230..1597204 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
K8B78_RS07520 (K8B78_07520)	-	1597256..1597879 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
K8B78_RS07525 (K8B78_07525)	-	1597876..1598205 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
K8B78_RS07530 (K8B78_07530)	-	1598205..1599191 (-)	987	WP_000161314.1	ROK family glucokinase	-

Sequence

Protein

Download Length: 165 a.a. Molecular weight: 19224.98 Da Isoelectric Point: 10.2192

                                >NTDB_id=602489 K8B78_RS07490 WP_001794055.1 1593738..1594235(-) (comGF) [Staphylococcus aureus strain SCAID WND1-2021 (598)]

MILSKVTNKFVLFQKIPLLIKRHVYSINVKAFSLIEMLVAMMVISITLLIVPDLIRLNKTFLIESRELTTVDFEFFSRDI

LEDFKGVDRNDIEIRQQRIILHKGEEMIEYKLINNKIIKVVNDRGNITMINNVTAFTANIYYKSIIKITITVKVGTNLQT

KTIYV

Nucleotide

Download Length: 498 bp

                                >NTDB_id=602489 K8B78_RS07490 WP_001794055.1 1593738..1594235(-) (comGF) [Staphylococcus aureus strain SCAID WND1-2021 (598)]

ATGATATTAAGCAAAGTGACCAACAAATTTGTGCTATTTCAAAAAATACCACTTCTTATCAAAAGACATGTATACAGTAT

TAATGTCAAAGCTTTTTCGCTAATTGAAATGTTAGTAGCGATGATGGTTATAAGTATAACTTTACTAATTGTTCCAGACT

TAATTAGACTTAACAAAACTTTTCTAATTGAAAGTAGGGAATTAACAACTGTAGATTTCGAATTTTTCTCAAGAGATATT

CTAGAGGATTTTAAAGGTGTAGATAGAAACGATATTGAAATTAGGCAACAGCGTATCATTTTACATAAAGGTGAAGAAAT

GATCGAATACAAATTAATAAATAATAAAATTATTAAAGTTGTAAATGACAGAGGAAATATAACAATGATTAATAATGTTA

CAGCATTTACTGCAAATATCTACTATAAATCTATTATTAAAATAACGATAACAGTTAAAGTCGGTACAAATCTGCAGACT

AAAACAATTTATGTATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(28-51)

Putative Competence protein ComGF (ComGF)

(68-155)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A7U7EV69

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGF	Staphylococcus aureus N315	98.182	100	0.982
comGF	Staphylococcus aureus MW2	96.97	100	0.97

Detailed information NTG0602489