Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   K7I17_RS12535 Genome accession   NZ_CP082279
Coordinates   2441315..2441752 (-) Length   145 a.a.
NCBI ID   WP_013352869.1    Uniprot ID   A0A9P1JIH3
Organism   Bacillus amyloliquefaciens strain Bam1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2436315..2446752
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K7I17_RS12485 (K7I17_12485) sinI 2436701..2436874 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  K7I17_RS12490 (K7I17_12490) sinR 2436908..2437243 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  K7I17_RS12495 (K7I17_12495) tasA 2437291..2438076 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  K7I17_RS12500 (K7I17_12500) sipW 2438141..2438725 (-) 585 WP_013352863.1 signal peptidase I SipW -
  K7I17_RS12505 (K7I17_12505) tapA 2438697..2439368 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  K7I17_RS12510 (K7I17_12510) - 2439626..2439955 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  K7I17_RS12515 (K7I17_12515) - 2439996..2440175 (-) 180 WP_013352866.1 YqzE family protein -
  K7I17_RS12520 (K7I17_12520) comGG 2440229..2440606 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  K7I17_RS12525 (K7I17_12525) comGF 2440608..2441108 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  K7I17_RS12530 (K7I17_12530) comGE 2441017..2441331 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  K7I17_RS12535 (K7I17_12535) comGD 2441315..2441752 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  K7I17_RS12540 (K7I17_12540) comGC 2441742..2442050 (-) 309 WP_013352870.1 competence type IV pilus major pilin ComGC Machinery gene
  K7I17_RS12545 (K7I17_12545) comGB 2442055..2443092 (-) 1038 WP_013352871.1 competence type IV pilus assembly protein ComGB Machinery gene
  K7I17_RS12550 (K7I17_12550) comGA 2443079..2444149 (-) 1071 WP_013352872.1 competence type IV pilus ATPase ComGA Machinery gene
  K7I17_RS12555 (K7I17_12555) - 2444343..2445293 (-) 951 WP_013352873.1 magnesium transporter CorA family protein -
  K7I17_RS12560 (K7I17_12560) - 2445440..2446741 (+) 1302 WP_013352874.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16256.71 Da        Isoelectric Point: 9.7141

>NTDB_id=600941 K7I17_RS12535 WP_013352869.1 2441315..2441752(-) (comGD) [Bacillus amyloliquefaciens strain Bam1]
MNNNRLTENGFTLLESLVVLSLASVLLTVLFTAVPPVYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSAGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITIYLGSGNVHAERK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=600941 K7I17_RS12535 WP_013352869.1 2441315..2441752(-) (comGD) [Bacillus amyloliquefaciens strain Bam1]
TTGAACAATAACCGGCTGACAGAAAACGGATTCACTCTTCTTGAAAGCCTGGTTGTGTTAAGTCTGGCGTCTGTATTGCT
GACTGTTTTGTTCACGGCGGTTCCGCCGGTTTATACCCATCTGGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGACA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACATTTCTCCCAAAAGAGCATAAATACAAG
CTGCAGTCAGCCGGAAGGATTGTTGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCCGGCGGAAAGATTCAATTGAAAAGCGCGGGATTCACTTATGAAATAACAATTT
ACTTAGGGAGCGGAAATGTCCATGCAGAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.115

95.862

0.538