Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   K7I17_RS12485 Genome accession   NZ_CP082279
Coordinates   2436701..2436874 (+) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus amyloliquefaciens strain Bam1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2431701..2441874
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K7I17_RS12470 (K7I17_12470) gcvT 2432512..2433612 (-) 1101 WP_013352857.1 glycine cleavage system aminomethyltransferase GcvT -
  K7I17_RS12475 (K7I17_12475) - 2434036..2435706 (+) 1671 WP_014470658.1 DEAD/DEAH box helicase -
  K7I17_RS12480 (K7I17_12480) - 2435727..2436521 (+) 795 WP_013352859.1 YqhG family protein -
  K7I17_RS12485 (K7I17_12485) sinI 2436701..2436874 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  K7I17_RS12490 (K7I17_12490) sinR 2436908..2437243 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  K7I17_RS12495 (K7I17_12495) tasA 2437291..2438076 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  K7I17_RS12500 (K7I17_12500) sipW 2438141..2438725 (-) 585 WP_013352863.1 signal peptidase I SipW -
  K7I17_RS12505 (K7I17_12505) tapA 2438697..2439368 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  K7I17_RS12510 (K7I17_12510) - 2439626..2439955 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  K7I17_RS12515 (K7I17_12515) - 2439996..2440175 (-) 180 WP_013352866.1 YqzE family protein -
  K7I17_RS12520 (K7I17_12520) comGG 2440229..2440606 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  K7I17_RS12525 (K7I17_12525) comGF 2440608..2441108 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  K7I17_RS12530 (K7I17_12530) comGE 2441017..2441331 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  K7I17_RS12535 (K7I17_12535) comGD 2441315..2441752 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=600937 K7I17_RS12485 WP_013352860.1 2436701..2436874(+) (sinI) [Bacillus amyloliquefaciens strain Bam1]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=600937 K7I17_RS12485 WP_013352860.1 2436701..2436874(+) (sinI) [Bacillus amyloliquefaciens strain Bam1]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684