Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   K7I17_RS01920 Genome accession   NZ_CP082279
Coordinates   382231..382350 (+) Length   39 a.a.
NCBI ID   WP_013351005.1    Uniprot ID   A0AAP7N4M9
Organism   Bacillus amyloliquefaciens strain Bam1     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 377231..387350
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K7I17_RS01905 (K7I17_01905) - 378843..379526 (+) 684 WP_013351002.1 response regulator transcription factor -
  K7I17_RS01910 (K7I17_01910) - 379513..380940 (+) 1428 WP_161988189.1 HAMP domain-containing sensor histidine kinase -
  K7I17_RS01915 (K7I17_01915) rapC 381099..382247 (+) 1149 WP_013351004.1 tetratricopeptide repeat protein Regulator
  K7I17_RS01920 (K7I17_01920) phrC 382231..382350 (+) 120 WP_013351005.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  K7I17_RS01925 (K7I17_01925) - 382498..382599 (-) 102 WP_013351006.1 YjcZ family sporulation protein -
  K7I17_RS01930 (K7I17_01930) - 382694..384058 (-) 1365 WP_014469748.1 aspartate kinase -
  K7I17_RS01935 (K7I17_01935) ceuB 384472..385425 (+) 954 WP_013351008.1 ABC transporter permease Machinery gene
  K7I17_RS01940 (K7I17_01940) - 385415..386362 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  K7I17_RS01945 (K7I17_01945) - 386356..387114 (+) 759 WP_013351009.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=600908 K7I17_RS01920 WP_013351005.1 382231..382350(+) (phrC) [Bacillus amyloliquefaciens strain Bam1]
MKLKSKWFVICLAAAAIFTAAGVSQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=600908 K7I17_RS01920 WP_013351005.1 382231..382350(+) (phrC) [Bacillus amyloliquefaciens strain Bam1]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGCTGCAGGTGTAAGCCAGACAGA
TCAGGCTGAATTCCATGTGGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

80

100

0.821