Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | K4A81_RS12965 | Genome accession | NZ_CP082262 |
| Coordinates | 2632835..2633008 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain BIM B-454D | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2627835..2638008
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K4A81_RS12950 (K4A81_12950) | gcvT | 2628648..2629748 (-) | 1101 | WP_061890721.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| K4A81_RS12955 (K4A81_12955) | - | 2630172..2631842 (+) | 1671 | WP_021494309.1 | DEAD/DEAH box helicase | - |
| K4A81_RS12960 (K4A81_12960) | - | 2631864..2632658 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| K4A81_RS12965 (K4A81_12965) | sinI | 2632835..2633008 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| K4A81_RS12970 (K4A81_12970) | sinR | 2633042..2633377 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| K4A81_RS12975 (K4A81_12975) | tasA | 2633425..2634210 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| K4A81_RS12980 (K4A81_12980) | sipW | 2634274..2634858 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| K4A81_RS12985 (K4A81_12985) | tapA | 2634830..2635501 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| K4A81_RS12990 (K4A81_12990) | - | 2635760..2636089 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| K4A81_RS12995 (K4A81_12995) | - | 2636130..2636309 (-) | 180 | WP_103526758.1 | YqzE family protein | - |
| K4A81_RS13000 (K4A81_13000) | comGG | 2636366..2636743 (-) | 378 | WP_021494310.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| K4A81_RS13005 (K4A81_13005) | comGF | 2636744..2637139 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| K4A81_RS13010 (K4A81_13010) | comGE | 2637153..2637467 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| K4A81_RS13015 (K4A81_13015) | comGD | 2637451..2637888 (-) | 438 | WP_095061019.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=600559 K4A81_RS12965 WP_014418369.1 2632835..2633008(+) (sinI) [Bacillus velezensis strain BIM B-454D]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=600559 K4A81_RS12965 WP_014418369.1 2632835..2633008(+) (sinI) [Bacillus velezensis strain BIM B-454D]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |