Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   K4A81_RS12965 Genome accession   NZ_CP082262
Coordinates   2632835..2633008 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain BIM B-454D     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2627835..2638008
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K4A81_RS12950 (K4A81_12950) gcvT 2628648..2629748 (-) 1101 WP_061890721.1 glycine cleavage system aminomethyltransferase GcvT -
  K4A81_RS12955 (K4A81_12955) - 2630172..2631842 (+) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  K4A81_RS12960 (K4A81_12960) - 2631864..2632658 (+) 795 WP_014418368.1 YqhG family protein -
  K4A81_RS12965 (K4A81_12965) sinI 2632835..2633008 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  K4A81_RS12970 (K4A81_12970) sinR 2633042..2633377 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  K4A81_RS12975 (K4A81_12975) tasA 2633425..2634210 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  K4A81_RS12980 (K4A81_12980) sipW 2634274..2634858 (-) 585 WP_012117977.1 signal peptidase I SipW -
  K4A81_RS12985 (K4A81_12985) tapA 2634830..2635501 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  K4A81_RS12990 (K4A81_12990) - 2635760..2636089 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  K4A81_RS12995 (K4A81_12995) - 2636130..2636309 (-) 180 WP_103526758.1 YqzE family protein -
  K4A81_RS13000 (K4A81_13000) comGG 2636366..2636743 (-) 378 WP_021494310.1 competence type IV pilus minor pilin ComGG Machinery gene
  K4A81_RS13005 (K4A81_13005) comGF 2636744..2637139 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  K4A81_RS13010 (K4A81_13010) comGE 2637153..2637467 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  K4A81_RS13015 (K4A81_13015) comGD 2637451..2637888 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=600559 K4A81_RS12965 WP_014418369.1 2632835..2633008(+) (sinI) [Bacillus velezensis strain BIM B-454D]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=600559 K4A81_RS12965 WP_014418369.1 2632835..2633008(+) (sinI) [Bacillus velezensis strain BIM B-454D]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719