Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   K4A81_RS13010 Genome accession   NZ_CP082262
Coordinates   2637153..2637467 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain BIM B-454D     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2632153..2642467
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K4A81_RS12965 (K4A81_12965) sinI 2632835..2633008 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  K4A81_RS12970 (K4A81_12970) sinR 2633042..2633377 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  K4A81_RS12975 (K4A81_12975) tasA 2633425..2634210 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  K4A81_RS12980 (K4A81_12980) sipW 2634274..2634858 (-) 585 WP_012117977.1 signal peptidase I SipW -
  K4A81_RS12985 (K4A81_12985) tapA 2634830..2635501 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  K4A81_RS12990 (K4A81_12990) - 2635760..2636089 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  K4A81_RS12995 (K4A81_12995) - 2636130..2636309 (-) 180 WP_103526758.1 YqzE family protein -
  K4A81_RS13000 (K4A81_13000) comGG 2636366..2636743 (-) 378 WP_021494310.1 competence type IV pilus minor pilin ComGG Machinery gene
  K4A81_RS13005 (K4A81_13005) comGF 2636744..2637139 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  K4A81_RS13010 (K4A81_13010) comGE 2637153..2637467 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  K4A81_RS13015 (K4A81_13015) comGD 2637451..2637888 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene
  K4A81_RS13020 (K4A81_13020) comGC 2637878..2638144 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  K4A81_RS13025 (K4A81_13025) comGB 2638191..2639228 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  K4A81_RS13030 (K4A81_13030) comGA 2639215..2640285 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  K4A81_RS13035 (K4A81_13035) - 2640478..2641428 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=600562 K4A81_RS13010 WP_017418140.1 2637153..2637467(-) (comGE) [Bacillus velezensis strain BIM B-454D]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=600562 K4A81_RS13010 WP_017418140.1 2637153..2637467(-) (comGE) [Bacillus velezensis strain BIM B-454D]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481