Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   K4A81_RS02020 Genome accession   NZ_CP082262
Coordinates   402559..402678 (+) Length   39 a.a.
NCBI ID   WP_103527149.1    Uniprot ID   -
Organism   Bacillus velezensis strain BIM B-454D     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 397559..407678
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K4A81_RS02005 (K4A81_02005) - 399171..399854 (+) 684 WP_014416901.1 response regulator transcription factor -
  K4A81_RS02010 (K4A81_02010) - 399841..401268 (+) 1428 WP_222885070.1 HAMP domain-containing sensor histidine kinase -
  K4A81_RS02015 (K4A81_02015) rapC 401427..402575 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  K4A81_RS02020 (K4A81_02020) phrC 402559..402678 (+) 120 WP_103527149.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  K4A81_RS02025 (K4A81_02025) - 402828..402938 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  K4A81_RS02030 (K4A81_02030) - 403018..404382 (-) 1365 WP_014416903.1 aspartate kinase -
  K4A81_RS02035 (K4A81_02035) ceuB 404796..405749 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  K4A81_RS02040 (K4A81_02040) - 405739..406686 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  K4A81_RS02045 (K4A81_02045) - 406680..407438 (+) 759 WP_063636991.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4243.97 Da        Isoelectric Point: 9.4191

>NTDB_id=600529 K4A81_RS02020 WP_103527149.1 402559..402678(+) (phrC) [Bacillus velezensis strain BIM B-454D]
MKLKSKWFVICLAAAAIFTVTGAGQTNQSEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=600529 K4A81_RS02020 WP_103527149.1 402559..402678(+) (phrC) [Bacillus velezensis strain BIM B-454D]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAAA
TCAGTCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

67.5

100

0.692