Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BAJP3042_RS15100 Genome accession   NZ_CP082243
Coordinates   3102408..3102548 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain JP3042     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3097408..3107548
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAJP3042_RS15075 (BAJP3042_15075) - 3097704..3098087 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  BAJP3042_RS15080 (BAJP3042_15080) comA 3098109..3098753 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  BAJP3042_RS15085 (BAJP3042_15085) comP 3098834..3101143 (-) 2310 WP_020954299.1 histidine kinase Regulator
  BAJP3042_RS15090 (BAJP3042_15090) - 3101163..3101339 (-) 177 WP_007408675.1 competence pheromone ComX -
  BAJP3042_RS15095 (BAJP3042_15095) comQ 3101339..3102223 (-) 885 WP_032865221.1 class 1 isoprenoid biosynthesis enzyme Regulator
  BAJP3042_RS15100 (BAJP3042_15100) degQ 3102408..3102548 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BAJP3042_RS15105 (BAJP3042_15105) - 3103014..3103355 (+) 342 WP_025285192.1 hypothetical protein -
  BAJP3042_RS15110 (BAJP3042_15110) - 3103362..3104585 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  BAJP3042_RS15115 (BAJP3042_15115) - 3104715..3106181 (-) 1467 WP_222835292.1 nicotinate phosphoribosyltransferase -
  BAJP3042_RS15120 (BAJP3042_15120) - 3106199..3106750 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  BAJP3042_RS15125 (BAJP3042_15125) - 3106847..3107245 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=600473 BAJP3042_RS15100 WP_003152043.1 3102408..3102548(-) (degQ) [Bacillus amyloliquefaciens strain JP3042]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=600473 BAJP3042_RS15100 WP_003152043.1 3102408..3102548(-) (degQ) [Bacillus amyloliquefaciens strain JP3042]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891