Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilE   Type   Machinery gene
Locus tag   NC852_RS11070 Genome accession   NZ_CP098466
Coordinates   2106523..2106666 (-) Length   47 a.a.
NCBI ID   WP_050303184.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 10720     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2101523..2111666
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NC852_RS11050 (NC852_10970) pilA 2102884..2104137 (+) 1254 WP_003687004.1 signal recognition particle-docking protein FtsY Machinery gene
  NC852_RS11055 (NC852_10975) - 2104270..2104428 (+) 159 WP_167550564.1 hypothetical protein -
  NC852_RS11060 (NC852_10980) - 2104402..2105214 (-) 813 WP_263584116.1 opacity family porin -
  NC852_RS12030 pilE 2105649..2105813 (-) 165 WP_003699316.1 hypothetical protein Machinery gene
  NC852_RS11065 (NC852_10985) pilE 2105786..2106154 (-) 369 WP_406946866.1 pilin Machinery gene
  NC852_RS11070 (NC852_10990) pilE 2106523..2106666 (-) 144 WP_050303184.1 hypothetical protein Machinery gene
  NC852_RS11075 (NC852_10995) - 2106771..2106851 (-) 81 Protein_2136 pilin -
  NC852_RS11080 (NC852_11000) - 2106922..2107292 (-) 371 Protein_2137 pilin -
  NC852_RS11085 (NC852_11005) - 2107332..2107736 (-) 405 Protein_2138 pilin -
  NC852_RS11090 (NC852_11010) pilE 2108226..2108642 (-) 417 WP_263584079.1 pilin Machinery gene
  NC852_RS11095 (NC852_11015) lpxC 2108748..2109671 (-) 924 WP_003687007.1 UDP-3-O-acyl-N-acetylglucosamine deacetylase -
  NC852_RS11925 - 2110173..2110889 (-) 717 WP_406946867.1 pilin -
  NC852_RS11115 (NC852_11035) - 2110915..2111130 (-) 216 Protein_2142 pilin -
  NC852_RS11120 (NC852_11040) - 2111503..2111634 (-) 132 WP_010356054.1 hypothetical protein -

Sequence

Protein


Download         Length: 47 a.a.        Molecular weight: 5006.49 Da        Isoelectric Point: 7.2429

>NTDB_id=599635 NC852_RS11070 WP_050303184.1 2106523..2106666(-) (pilE) [Neisseria gonorrhoeae strain 10720]
MTGFNDAAGNEKIDTKHLPSTCRDKSSAGCTKHHAPISNAFQENGAF

Nucleotide


Download         Length: 144 bp        

>NTDB_id=599635 NC852_RS11070 WP_050303184.1 2106523..2106666(-) (pilE) [Neisseria gonorrhoeae strain 10720]
ATGACGGGATTTAATGATGCCGCCGGCAACGAAAAAATCGACACCAAGCACCTGCCGTCAACCTGCCGCGATAAATCATC
TGCCGGTTGCACGAAACACCACGCGCCGATTTCAAATGCTTTCCAAGAAAACGGAGCTTTTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilE Neisseria gonorrhoeae strain FA1090

70

63.83

0.447