Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   K4120_RS11895 Genome accession   NZ_CP081488
Coordinates   2470581..2471018 (-) Length   145 a.a.
NCBI ID   WP_007408322.1    Uniprot ID   -
Organism   Bacillus velezensis strain LZN01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2465581..2476018
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K4120_RS11845 (K4120_11845) sinI 2465972..2466145 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  K4120_RS11850 (K4120_11850) sinR 2466179..2466514 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  K4120_RS11855 (K4120_11855) tasA 2466562..2467347 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  K4120_RS11860 (K4120_11860) sipW 2467412..2467996 (-) 585 WP_015240205.1 signal peptidase I SipW -
  K4120_RS11865 (K4120_11865) tapA 2467968..2468639 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  K4120_RS11870 (K4120_11870) - 2468898..2469227 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  K4120_RS11875 (K4120_11875) - 2469267..2469446 (-) 180 WP_003153093.1 YqzE family protein -
  K4120_RS11880 (K4120_11880) comGG 2469503..2469880 (-) 378 WP_032866434.1 competence type IV pilus minor pilin ComGG Machinery gene
  K4120_RS19595 comGF 2469881..2470048 (-) 168 WP_235183824.1 ComGF family competence protein Machinery gene
  K4120_RS19600 - 2470045..2470239 (-) 195 WP_225917419.1 hypothetical protein -
  K4120_RS11890 (K4120_11890) comGE 2470283..2470597 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  K4120_RS11895 (K4120_11895) comGD 2470581..2471018 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene
  K4120_RS11900 (K4120_11900) comGC 2471008..2471316 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  K4120_RS11905 (K4120_11905) comGB 2471321..2472358 (-) 1038 WP_032866436.1 competence type IV pilus assembly protein ComGB Machinery gene
  K4120_RS11910 (K4120_11910) comGA 2472345..2473415 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  K4120_RS11915 (K4120_11915) - 2473607..2474557 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -
  K4120_RS11920 (K4120_11920) - 2474703..2476004 (+) 1302 WP_032866438.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16314.79 Da        Isoelectric Point: 10.2475

>NTDB_id=596887 K4120_RS11895 WP_007408322.1 2470581..2471018(-) (comGD) [Bacillus velezensis strain LZN01]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=596887 K4120_RS11895 WP_007408322.1 2470581..2471018(-) (comGD) [Bacillus velezensis strain LZN01]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566