Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   K4120_RS11845 Genome accession   NZ_CP081488
Coordinates   2465972..2466145 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain LZN01     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2460972..2471145
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K4120_RS11830 (K4120_11830) gcvT 2461785..2462885 (-) 1101 WP_032866432.1 glycine cleavage system aminomethyltransferase GcvT -
  K4120_RS11835 (K4120_11835) - 2463309..2464979 (+) 1671 WP_007408331.1 DEAD/DEAH box helicase -
  K4120_RS11840 (K4120_11840) - 2465001..2465795 (+) 795 WP_007408330.1 YqhG family protein -
  K4120_RS11845 (K4120_11845) sinI 2465972..2466145 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  K4120_RS11850 (K4120_11850) sinR 2466179..2466514 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  K4120_RS11855 (K4120_11855) tasA 2466562..2467347 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  K4120_RS11860 (K4120_11860) sipW 2467412..2467996 (-) 585 WP_015240205.1 signal peptidase I SipW -
  K4120_RS11865 (K4120_11865) tapA 2467968..2468639 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  K4120_RS11870 (K4120_11870) - 2468898..2469227 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  K4120_RS11875 (K4120_11875) - 2469267..2469446 (-) 180 WP_003153093.1 YqzE family protein -
  K4120_RS11880 (K4120_11880) comGG 2469503..2469880 (-) 378 WP_032866434.1 competence type IV pilus minor pilin ComGG Machinery gene
  K4120_RS19595 comGF 2469881..2470048 (-) 168 WP_235183824.1 ComGF family competence protein Machinery gene
  K4120_RS19600 - 2470045..2470239 (-) 195 WP_225917419.1 hypothetical protein -
  K4120_RS11890 (K4120_11890) comGE 2470283..2470597 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  K4120_RS11895 (K4120_11895) comGD 2470581..2471018 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=596884 K4120_RS11845 WP_003153105.1 2465972..2466145(+) (sinI) [Bacillus velezensis strain LZN01]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=596884 K4120_RS11845 WP_003153105.1 2465972..2466145(+) (sinI) [Bacillus velezensis strain LZN01]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702