Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | K4120_RS11845 | Genome accession | NZ_CP081488 |
| Coordinates | 2465972..2466145 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain LZN01 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2460972..2471145
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K4120_RS11830 (K4120_11830) | gcvT | 2461785..2462885 (-) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| K4120_RS11835 (K4120_11835) | - | 2463309..2464979 (+) | 1671 | WP_007408331.1 | DEAD/DEAH box helicase | - |
| K4120_RS11840 (K4120_11840) | - | 2465001..2465795 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| K4120_RS11845 (K4120_11845) | sinI | 2465972..2466145 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| K4120_RS11850 (K4120_11850) | sinR | 2466179..2466514 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| K4120_RS11855 (K4120_11855) | tasA | 2466562..2467347 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| K4120_RS11860 (K4120_11860) | sipW | 2467412..2467996 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| K4120_RS11865 (K4120_11865) | tapA | 2467968..2468639 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| K4120_RS11870 (K4120_11870) | - | 2468898..2469227 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| K4120_RS11875 (K4120_11875) | - | 2469267..2469446 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| K4120_RS11880 (K4120_11880) | comGG | 2469503..2469880 (-) | 378 | WP_032866434.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| K4120_RS19595 | comGF | 2469881..2470048 (-) | 168 | WP_235183824.1 | ComGF family competence protein | Machinery gene |
| K4120_RS19600 | - | 2470045..2470239 (-) | 195 | WP_225917419.1 | hypothetical protein | - |
| K4120_RS11890 (K4120_11890) | comGE | 2470283..2470597 (-) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| K4120_RS11895 (K4120_11895) | comGD | 2470581..2471018 (-) | 438 | WP_007408322.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=596884 K4120_RS11845 WP_003153105.1 2465972..2466145(+) (sinI) [Bacillus velezensis strain LZN01]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=596884 K4120_RS11845 WP_003153105.1 2465972..2466145(+) (sinI) [Bacillus velezensis strain LZN01]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |