Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   K3A92_RS11595 Genome accession   NZ_CP080760
Coordinates   2436281..2436658 (-) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain B4-7     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2431281..2441658
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K3A92_RS11555 (K3A92_11555) - 2431778..2432572 (+) 795 WP_007612541.1 YqhG family protein -
  K3A92_RS11560 (K3A92_11560) sinI 2432749..2432922 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  K3A92_RS11565 (K3A92_11565) sinR 2432956..2433291 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  K3A92_RS11570 (K3A92_11570) tasA 2433339..2434124 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  K3A92_RS11575 (K3A92_11575) sipW 2434189..2434773 (-) 585 WP_032874025.1 signal peptidase I SipW -
  K3A92_RS11580 (K3A92_11580) tapA 2434745..2435416 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  K3A92_RS11585 (K3A92_11585) - 2435675..2436004 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  K3A92_RS11590 (K3A92_11590) - 2436045..2436224 (-) 180 WP_022552966.1 YqzE family protein -
  K3A92_RS11595 (K3A92_11595) comGG 2436281..2436658 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  K3A92_RS11600 (K3A92_11600) comGF 2436659..2437159 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  K3A92_RS11605 (K3A92_11605) comGE 2437068..2437382 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  K3A92_RS11610 (K3A92_11610) comGD 2437366..2437803 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  K3A92_RS11615 (K3A92_11615) comGC 2437793..2438101 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  K3A92_RS11620 (K3A92_11620) comGB 2438106..2439143 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  K3A92_RS11625 (K3A92_11625) comGA 2439130..2440200 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  K3A92_RS11630 (K3A92_11630) - 2440397..2441347 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=594740 K3A92_RS11595 WP_032874019.1 2436281..2436658(-) (comGG) [Bacillus velezensis strain B4-7]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=594740 K3A92_RS11595 WP_032874019.1 2436281..2436658(-) (comGG) [Bacillus velezensis strain B4-7]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488