Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   K3A92_RS11560 Genome accession   NZ_CP080760
Coordinates   2432749..2432922 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain B4-7     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2427749..2437922
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K3A92_RS11545 (K3A92_11545) gcvT 2428563..2429663 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  K3A92_RS11550 (K3A92_11550) - 2430086..2431756 (+) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  K3A92_RS11555 (K3A92_11555) - 2431778..2432572 (+) 795 WP_007612541.1 YqhG family protein -
  K3A92_RS11560 (K3A92_11560) sinI 2432749..2432922 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  K3A92_RS11565 (K3A92_11565) sinR 2432956..2433291 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  K3A92_RS11570 (K3A92_11570) tasA 2433339..2434124 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  K3A92_RS11575 (K3A92_11575) sipW 2434189..2434773 (-) 585 WP_032874025.1 signal peptidase I SipW -
  K3A92_RS11580 (K3A92_11580) tapA 2434745..2435416 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  K3A92_RS11585 (K3A92_11585) - 2435675..2436004 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  K3A92_RS11590 (K3A92_11590) - 2436045..2436224 (-) 180 WP_022552966.1 YqzE family protein -
  K3A92_RS11595 (K3A92_11595) comGG 2436281..2436658 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  K3A92_RS11600 (K3A92_11600) comGF 2436659..2437159 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  K3A92_RS11605 (K3A92_11605) comGE 2437068..2437382 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  K3A92_RS11610 (K3A92_11610) comGD 2437366..2437803 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=594738 K3A92_RS11560 WP_032874029.1 2432749..2432922(+) (sinI) [Bacillus velezensis strain B4-7]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=594738 K3A92_RS11560 WP_032874029.1 2432749..2432922(+) (sinI) [Bacillus velezensis strain B4-7]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719