Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   K3G18_RS16290 Genome accession   NZ_CP080629
Coordinates   3136569..3136709 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain YPS-32     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3131569..3141709
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K3G18_RS16265 (K3G18_16265) yuxO 3131846..3132226 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  K3G18_RS16270 (K3G18_16270) comA 3132245..3132889 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  K3G18_RS16275 (K3G18_16275) comP 3132970..3135282 (-) 2313 WP_032722435.1 histidine kinase Regulator
  K3G18_RS16280 (K3G18_16280) comX 3135298..3135519 (-) 222 WP_014480704.1 competence pheromone ComX -
  K3G18_RS16285 (K3G18_16285) - 3135521..3136384 (-) 864 WP_032722437.1 polyprenyl synthetase family protein -
  K3G18_RS16290 (K3G18_16290) degQ 3136569..3136709 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  K3G18_RS16295 (K3G18_16295) - 3136931..3137056 (+) 126 WP_003228793.1 hypothetical protein -
  K3G18_RS16300 (K3G18_16300) - 3137170..3137538 (+) 369 WP_014477834.1 hypothetical protein -
  K3G18_RS16305 (K3G18_16305) pdeH 3137514..3138743 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  K3G18_RS16310 (K3G18_16310) pncB 3138880..3140352 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  K3G18_RS16315 (K3G18_16315) pncA 3140368..3140919 (-) 552 WP_220562272.1 cysteine hydrolase family protein -
  K3G18_RS16320 (K3G18_16320) yueI 3141016..3141414 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=594539 K3G18_RS16290 WP_003220708.1 3136569..3136709(-) (degQ) [Bacillus subtilis strain YPS-32]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=594539 K3G18_RS16290 WP_003220708.1 3136569..3136709(-) (degQ) [Bacillus subtilis strain YPS-32]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1