Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   K3G18_RS12135 Genome accession   NZ_CP080629
Coordinates   2385072..2385455 (-) Length   127 a.a.
NCBI ID   WP_032722118.1    Uniprot ID   -
Organism   Bacillus subtilis strain YPS-32     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2380072..2390455
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K3G18_RS12095 (K3G18_12095) sinI 2381005..2381178 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  K3G18_RS12100 (K3G18_12100) sinR 2381212..2381547 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  K3G18_RS12105 (K3G18_12105) tasA 2381640..2382425 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  K3G18_RS12110 (K3G18_12110) sipW 2382489..2383061 (-) 573 WP_072692741.1 signal peptidase I SipW -
  K3G18_RS12115 (K3G18_12115) tapA 2383045..2383806 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  K3G18_RS12120 (K3G18_12120) yqzG 2384078..2384404 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  K3G18_RS12125 (K3G18_12125) spoIITA 2384446..2384625 (-) 180 WP_029726723.1 YqzE family protein -
  K3G18_RS12130 (K3G18_12130) comGG 2384697..2385071 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  K3G18_RS12135 (K3G18_12135) comGF 2385072..2385455 (-) 384 WP_032722118.1 ComG operon protein ComGF Machinery gene
  K3G18_RS12140 (K3G18_12140) comGE 2385481..2385828 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  K3G18_RS12145 (K3G18_12145) comGD 2385812..2386243 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  K3G18_RS12150 (K3G18_12150) comGC 2386233..2386529 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  K3G18_RS12155 (K3G18_12155) comGB 2386543..2387580 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  K3G18_RS12160 (K3G18_12160) comGA 2387567..2388637 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  K3G18_RS12165 (K3G18_12165) - 2388850..2389047 (-) 198 WP_014480259.1 CBS domain-containing protein -
  K3G18_RS12170 (K3G18_12170) corA 2389049..2390002 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14375.50 Da        Isoelectric Point: 5.8940

>NTDB_id=594518 K3G18_RS12135 WP_032722118.1 2385072..2385455(-) (comGF) [Bacillus subtilis strain YPS-32]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=594518 K3G18_RS12135 WP_032722118.1 2385072..2385455(-) (comGF) [Bacillus subtilis strain YPS-32]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976