Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   KTJ85_RS14945 Genome accession   NZ_CP080509
Coordinates   2918508..2918648 (-) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus sp. 7D3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2913508..2923648
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KTJ85_RS14915 (KTJ85_14915) - 2913570..2913953 (-) 384 WP_212099079.1 hotdog fold thioesterase -
  KTJ85_RS14920 (KTJ85_14920) comA 2913975..2914619 (-) 645 WP_014472195.1 response regulator transcription factor Regulator
  KTJ85_RS14925 (KTJ85_14925) - 2914700..2915494 (-) 795 Protein_2948 sensor histidine kinase -
  KTJ85_RS14930 (KTJ85_14930) comP 2915741..2917081 (-) 1341 WP_258567386.1 hypothetical protein Regulator
  KTJ85_RS14935 (KTJ85_14935) comX 2917284..2917454 (-) 171 WP_212099082.1 competence pheromone ComX -
  KTJ85_RS14940 (KTJ85_14940) comQ 2917469..2918377 (-) 909 WP_249199260.1 polyprenyl synthetase family protein Regulator
  KTJ85_RS14945 (KTJ85_14945) degQ 2918508..2918648 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  KTJ85_RS14950 (KTJ85_14950) - 2919113..2919454 (+) 342 WP_115997039.1 hypothetical protein -
  KTJ85_RS14955 (KTJ85_14955) - 2919460..2920683 (-) 1224 WP_115997038.1 EAL and HDOD domain-containing protein -
  KTJ85_RS14960 (KTJ85_14960) - 2920813..2922279 (-) 1467 WP_115997037.1 nicotinate phosphoribosyltransferase -
  KTJ85_RS14965 (KTJ85_14965) - 2922297..2922848 (-) 552 WP_212099085.1 cysteine hydrolase family protein -
  KTJ85_RS14970 (KTJ85_14970) - 2922929..2923324 (-) 396 WP_013353403.1 YueI family protein -
  KTJ85_RS14975 (KTJ85_14975) - 2923390..2923638 (-) 249 WP_013353404.1 YueH family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=593419 KTJ85_RS14945 WP_013353398.1 2918508..2918648(-) (degQ) [Bacillus sp. 7D3]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=593419 KTJ85_RS14945 WP_013353398.1 2918508..2918648(-) (degQ) [Bacillus sp. 7D3]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P06532

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913