Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | KTJ85_RS11610 | Genome accession | NZ_CP080509 |
| Coordinates | 2310116..2310289 (+) | Length | 57 a.a. |
| NCBI ID | WP_013352860.1 | Uniprot ID | A0A9P1JIA1 |
| Organism | Bacillus sp. 7D3 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2305116..2315289
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KTJ85_RS11595 (KTJ85_11595) | gcvT | 2305927..2307027 (-) | 1101 | WP_115997629.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| KTJ85_RS11600 (KTJ85_11600) | - | 2307451..2309121 (+) | 1671 | WP_065981874.1 | DEAD/DEAH box helicase | - |
| KTJ85_RS11605 (KTJ85_11605) | - | 2309142..2309936 (+) | 795 | WP_065981875.1 | YqhG family protein | - |
| KTJ85_RS11610 (KTJ85_11610) | sinI | 2310116..2310289 (+) | 174 | WP_013352860.1 | anti-repressor SinI | Regulator |
| KTJ85_RS11615 (KTJ85_11615) | sinR | 2310323..2310658 (+) | 336 | WP_014470659.1 | transcriptional regulator SinR | Regulator |
| KTJ85_RS11620 (KTJ85_11620) | tasA | 2310706..2311491 (-) | 786 | WP_013352862.1 | biofilm matrix protein TasA | - |
| KTJ85_RS11625 (KTJ85_11625) | sipW | 2311556..2312140 (-) | 585 | WP_212098460.1 | signal peptidase I SipW | - |
| KTJ85_RS11630 (KTJ85_11630) | tapA | 2312112..2312783 (-) | 672 | WP_212098462.1 | amyloid fiber anchoring/assembly protein TapA | - |
| KTJ85_RS11635 (KTJ85_11635) | - | 2313041..2313370 (+) | 330 | WP_045510605.1 | DUF3889 domain-containing protein | - |
| KTJ85_RS11640 (KTJ85_11640) | - | 2313411..2313590 (-) | 180 | WP_016938971.1 | YqzE family protein | - |
| KTJ85_RS11645 (KTJ85_11645) | comGG | 2313647..2314024 (-) | 378 | WP_212098464.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| KTJ85_RS11650 (KTJ85_11650) | comGF | 2314026..2314526 (-) | 501 | WP_249199234.1 | competence type IV pilus minor pilin ComGF | - |
| KTJ85_RS11655 (KTJ85_11655) | comGE | 2314435..2314749 (-) | 315 | WP_065981881.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| KTJ85_RS11660 (KTJ85_11660) | comGD | 2314733..2315170 (-) | 438 | WP_045510590.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6689.61 Da Isoelectric Point: 9.8173
>NTDB_id=593396 KTJ85_RS11610 WP_013352860.1 2310116..2310289(+) (sinI) [Bacillus sp. 7D3]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=593396 KTJ85_RS11610 WP_013352860.1 2310116..2310289(+) (sinI) [Bacillus sp. 7D3]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
68.421 |
100 |
0.684 |