Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KYI11_RS10905 | Genome accession | NZ_CP079981 |
| Coordinates | 2066885..2067373 (-) | Length | 162 a.a. |
| NCBI ID | WP_219502948.1 | Uniprot ID | A0AAJ4PAN1 |
| Organism | Macrococcoides bohemicum strain 19Msa0936 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2033331..2073860 | 2066885..2067373 | within | 0 |
Gene organization within MGE regions
Location: 2033331..2073860
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KYI11_RS10685 (KYI11_10695) | abc-f | 2033331..2035247 (+) | 1917 | WP_219502853.1 | ribosomal protection-like ABC-F family protein | - |
| KYI11_RS12705 | - | 2035799..2036536 (-) | 738 | WP_244994959.1 | LysM peptidoglycan-binding domain-containing protein | - |
| KYI11_RS12710 | - | 2036516..2037397 (-) | 882 | Protein_2097 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| KYI11_RS10695 (KYI11_10705) | - | 2037390..2037731 (-) | 342 | WP_219502857.1 | phage holin | - |
| KYI11_RS10700 (KYI11_10710) | - | 2037765..2038058 (-) | 294 | WP_219502859.1 | hypothetical protein | - |
| KYI11_RS10705 (KYI11_10715) | - | 2038130..2041858 (-) | 3729 | WP_219502862.1 | BppU family phage baseplate upper protein | - |
| KYI11_RS10710 (KYI11_10720) | - | 2041888..2042253 (-) | 366 | WP_219502865.1 | hypothetical protein | - |
| KYI11_RS10715 (KYI11_10725) | - | 2042243..2045728 (-) | 3486 | WP_219502868.1 | phage tail spike protein | - |
| KYI11_RS10720 (KYI11_10730) | - | 2045744..2047207 (-) | 1464 | WP_219502871.1 | phage distal tail protein | - |
| KYI11_RS12805 | - | 2047235..2051383 (-) | 4149 | WP_280636225.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| KYI11_RS10730 (KYI11_10740) | gpGT | 2051422..2051571 (-) | 150 | WP_158554317.1 | phage tail assembly chaperone GT | - |
| KYI11_RS10735 (KYI11_10745) | gpG | 2051604..2051942 (-) | 339 | WP_133354665.1 | phage tail assembly chaperone G | - |
| KYI11_RS10740 (KYI11_10750) | - | 2051969..2052160 (-) | 192 | WP_219502875.1 | hypothetical protein | - |
| KYI11_RS10745 (KYI11_10755) | - | 2052238..2052852 (-) | 615 | WP_219502878.1 | major tail protein | - |
| KYI11_RS10750 (KYI11_10760) | - | 2052869..2053279 (-) | 411 | WP_219502881.1 | hypothetical protein | - |
| KYI11_RS10755 (KYI11_10765) | - | 2053276..2053671 (-) | 396 | WP_219502884.1 | hypothetical protein | - |
| KYI11_RS10760 (KYI11_10770) | - | 2053661..2054035 (-) | 375 | WP_219502887.1 | hypothetical protein | - |
| KYI11_RS10765 (KYI11_10775) | - | 2054019..2054306 (-) | 288 | WP_133354677.1 | phage gp6-like head-tail connector protein | - |
| KYI11_RS10770 (KYI11_10780) | - | 2054315..2054476 (-) | 162 | WP_219502888.1 | hypothetical protein | - |
| KYI11_RS10775 (KYI11_10785) | - | 2054520..2055707 (-) | 1188 | WP_219502891.1 | phage major capsid protein | - |
| KYI11_RS10780 (KYI11_10790) | - | 2055719..2056504 (-) | 786 | WP_219502893.1 | head maturation protease, ClpP-related | - |
| KYI11_RS10785 (KYI11_10795) | - | 2056501..2057616 (-) | 1116 | WP_244994885.1 | phage portal protein | - |
| KYI11_RS10790 (KYI11_10800) | - | 2057666..2059348 (-) | 1683 | WP_219502896.1 | terminase TerL endonuclease subunit | - |
| KYI11_RS10795 (KYI11_10805) | - | 2059345..2059638 (-) | 294 | WP_219502899.1 | P27 family phage terminase small subunit | - |
| KYI11_RS10800 (KYI11_10810) | - | 2059767..2060084 (-) | 318 | WP_414739215.1 | HNH endonuclease | - |
| KYI11_RS10805 (KYI11_10815) | - | 2060191..2060628 (-) | 438 | WP_219502906.1 | transcriptional regulator | - |
| KYI11_RS10810 (KYI11_10820) | - | 2060730..2060918 (-) | 189 | WP_219502909.1 | hypothetical protein | - |
| KYI11_RS10815 (KYI11_10825) | - | 2060915..2061277 (-) | 363 | WP_219502912.1 | YopX family protein | - |
| KYI11_RS10820 (KYI11_10830) | - | 2061473..2061703 (-) | 231 | WP_219502915.1 | hypothetical protein | - |
| KYI11_RS10825 (KYI11_10835) | - | 2061882..2062130 (-) | 249 | WP_219502918.1 | hypothetical protein | - |
| KYI11_RS10830 (KYI11_10840) | - | 2062127..2062486 (-) | 360 | WP_219502920.1 | hypothetical protein | - |
| KYI11_RS10835 (KYI11_10845) | - | 2062529..2062969 (-) | 441 | WP_219502923.1 | hypothetical protein | - |
| KYI11_RS10840 (KYI11_10850) | - | 2062950..2063132 (-) | 183 | WP_219502926.1 | hypothetical protein | - |
| KYI11_RS10845 (KYI11_10855) | - | 2063137..2063406 (-) | 270 | WP_219502927.1 | hypothetical protein | - |
| KYI11_RS10850 (KYI11_10860) | - | 2063403..2063825 (-) | 423 | WP_219502928.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KYI11_RS10855 (KYI11_10865) | - | 2063812..2063970 (-) | 159 | WP_219502929.1 | hypothetical protein | - |
| KYI11_RS10860 (KYI11_10870) | - | 2063960..2064463 (-) | 504 | WP_219502930.1 | hypothetical protein | - |
| KYI11_RS10865 (KYI11_10875) | - | 2064560..2064985 (-) | 426 | WP_219502931.1 | dUTP diphosphatase | - |
| KYI11_RS12810 | - | 2064972..2065094 (-) | 123 | WP_280636226.1 | hypothetical protein | - |
| KYI11_RS10870 (KYI11_10880) | - | 2065094..2065288 (-) | 195 | WP_219502932.1 | hypothetical protein | - |
| KYI11_RS10875 (KYI11_10885) | - | 2065272..2065529 (-) | 258 | WP_219502933.1 | hypothetical protein | - |
| KYI11_RS10880 (KYI11_10890) | - | 2065539..2065775 (-) | 237 | WP_099576821.1 | hypothetical protein | - |
| KYI11_RS10885 (KYI11_10895) | - | 2065765..2065980 (-) | 216 | WP_219502935.1 | hypothetical protein | - |
| KYI11_RS10890 (KYI11_10900) | - | 2065984..2066319 (-) | 336 | WP_219502939.1 | hypothetical protein | - |
| KYI11_RS10895 (KYI11_10905) | - | 2066312..2066569 (-) | 258 | WP_219502942.1 | hypothetical protein | - |
| KYI11_RS10900 (KYI11_10910) | - | 2066588..2066872 (-) | 285 | WP_219502945.1 | helix-turn-helix domain-containing protein | - |
| KYI11_RS10905 (KYI11_10915) | ssbA | 2066885..2067373 (-) | 489 | WP_219502948.1 | single-stranded DNA-binding protein | Machinery gene |
| KYI11_RS10910 (KYI11_10920) | - | 2067470..2068423 (-) | 954 | WP_219502950.1 | DnaD domain protein | - |
| KYI11_RS10915 (KYI11_10925) | - | 2068416..2068691 (-) | 276 | WP_219502952.1 | hypothetical protein | - |
| KYI11_RS10920 (KYI11_10930) | - | 2068678..2068920 (-) | 243 | WP_219502954.1 | hypothetical protein | - |
| KYI11_RS10925 (KYI11_10935) | - | 2068913..2069698 (-) | 786 | WP_219502958.1 | phage antirepressor | - |
| KYI11_RS10930 (KYI11_10940) | - | 2069814..2070005 (-) | 192 | WP_219502959.1 | hypothetical protein | - |
| KYI11_RS10935 (KYI11_10945) | - | 2070002..2070169 (-) | 168 | WP_219502961.1 | hypothetical protein | - |
| KYI11_RS10940 (KYI11_10950) | - | 2070210..2070410 (-) | 201 | WP_219502962.1 | hypothetical protein | - |
| KYI11_RS10945 (KYI11_10955) | - | 2070403..2070663 (-) | 261 | WP_219502965.1 | helix-turn-helix transcriptional regulator | - |
| KYI11_RS10950 (KYI11_10960) | - | 2070829..2071215 (+) | 387 | WP_219502967.1 | helix-turn-helix domain-containing protein | - |
| KYI11_RS10955 (KYI11_10965) | - | 2071228..2071644 (+) | 417 | WP_219502969.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KYI11_RS10960 (KYI11_10970) | - | 2071657..2072550 (+) | 894 | WP_219502971.1 | HIRAN domain-containing protein | - |
| KYI11_RS10965 (KYI11_10975) | - | 2072661..2073860 (+) | 1200 | WP_219502973.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 162 a.a. Molecular weight: 18023.71 Da Isoelectric Point: 4.6984
>NTDB_id=590591 KYI11_RS10905 WP_219502948.1 2066885..2067373(-) (ssbA) [Macrococcoides bohemicum strain 19Msa0936]
MLNRFIGVGRLTADPQYRVTPSGVSVTTFTLAINRTFTNAQGERQADFINCVTFKKQAENVNNFLSKGSLAGVDGRLQSR
SYDNQEGRRIFVTEVICDSVQFLEPKGTRNDGSQYDDYPQAQQSSPNDYQQQNKKAQQSAPNTNPFANSDGPIDISDDDL
PF
MLNRFIGVGRLTADPQYRVTPSGVSVTTFTLAINRTFTNAQGERQADFINCVTFKKQAENVNNFLSKGSLAGVDGRLQSR
SYDNQEGRRIFVTEVICDSVQFLEPKGTRNDGSQYDDYPQAQQSSPNDYQQQNKKAQQSAPNTNPFANSDGPIDISDDDL
PF
Nucleotide
Download Length: 489 bp
>NTDB_id=590591 KYI11_RS10905 WP_219502948.1 2066885..2067373(-) (ssbA) [Macrococcoides bohemicum strain 19Msa0936]
ATGTTAAATCGTTTTATAGGCGTTGGTAGGCTTACAGCTGATCCACAATATCGAGTAACGCCATCTGGTGTATCAGTAAC
GACATTCACATTAGCAATCAACAGAACATTCACTAATGCACAGGGTGAAAGACAAGCAGATTTCATTAATTGTGTGACAT
TCAAGAAACAAGCTGAAAACGTCAATAACTTTTTAAGTAAAGGTTCTCTTGCTGGTGTTGATGGTAGATTACAGTCACGT
AGCTATGACAATCAAGAAGGTAGAAGAATATTCGTTACTGAAGTGATTTGTGACTCAGTGCAATTCCTAGAACCAAAAGG
AACGAGAAATGATGGTAGTCAGTATGATGATTATCCACAAGCGCAACAATCATCACCAAACGATTACCAGCAACAAAATA
AAAAGGCGCAACAAAGCGCACCAAATACAAATCCATTCGCAAATTCTGATGGACCTATAGATATATCAGATGACGATTTA
CCGTTCTAA
ATGTTAAATCGTTTTATAGGCGTTGGTAGGCTTACAGCTGATCCACAATATCGAGTAACGCCATCTGGTGTATCAGTAAC
GACATTCACATTAGCAATCAACAGAACATTCACTAATGCACAGGGTGAAAGACAAGCAGATTTCATTAATTGTGTGACAT
TCAAGAAACAAGCTGAAAACGTCAATAACTTTTTAAGTAAAGGTTCTCTTGCTGGTGTTGATGGTAGATTACAGTCACGT
AGCTATGACAATCAAGAAGGTAGAAGAATATTCGTTACTGAAGTGATTTGTGACTCAGTGCAATTCCTAGAACCAAAAGG
AACGAGAAATGATGGTAGTCAGTATGATGATTATCCACAAGCGCAACAATCATCACCAAACGATTACCAGCAACAAAATA
AAAAGGCGCAACAAAGCGCACCAAATACAAATCCATTCGCAAATTCTGATGGACCTATAGATATATCAGATGACGATTTA
CCGTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.977 |
100 |
0.605 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
49.708 |
100 |
0.525 |