Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BALI_RS13255 Genome accession   NC_021362
Coordinates   2712116..2712292 (+) Length   58 a.a.
NCBI ID   WP_020452165.1    Uniprot ID   -
Organism   Bacillus paralicheniformis ATCC 9945a     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2707116..2717292
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BALI_RS13235 (BaLi_c27170) gcvT 2707756..2708850 (-) 1095 WP_020452162.1 glycine cleavage system aminomethyltransferase GcvT -
  BALI_RS13245 (BaLi_c27180) - 2709445..2711124 (+) 1680 WP_020452163.1 DEAD/DEAH box helicase -
  BALI_RS13250 (BaLi_c27190) - 2711131..2711925 (+) 795 WP_020452164.1 YqhG family protein -
  BALI_RS13255 (BaLi_c27191) sinI 2712116..2712292 (+) 177 WP_020452165.1 anti-repressor SinI Regulator
  BALI_RS13260 (BaLi_c27200) sinR 2712326..2712661 (+) 336 WP_023855185.1 transcriptional regulator SinR Regulator
  BALI_RS13265 (BaLi_c27210) tasA 2712766..2713560 (-) 795 WP_020452167.1 biofilm matrix protein TasA -
  BALI_RS13270 (BaLi_c27220) sipW 2713633..2714217 (-) 585 WP_020452168.1 signal peptidase I SipW -
  BALI_RS13275 (BaLi_c27230) tapA 2714214..2714942 (-) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  BALI_RS13280 (BaLi_c27240) - 2715220..2715540 (+) 321 WP_020452170.1 YqzG/YhdC family protein -
  BALI_RS13285 (BaLi_c27241) - 2715570..2715752 (-) 183 WP_020452171.1 YqzE family protein -
  BALI_RS13290 (BaLi_c27250) comGG 2715841..2716206 (-) 366 WP_020452172.1 competence type IV pilus minor pilin ComGG -
  BALI_RS13295 (BaLi_c27260) comGF 2716218..2716706 (-) 489 WP_236613657.1 competence type IV pilus minor pilin ComGF -
  BALI_RS13300 (BaLi_c27261) comGE 2716615..2716962 (-) 348 WP_020452174.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6694.49 Da        Isoelectric Point: 5.0637

>NTDB_id=59006 BALI_RS13255 WP_020452165.1 2712116..2712292(+) (sinI) [Bacillus paralicheniformis ATCC 9945a]
MNKDKNEKEELDEEWTELIKHALEQGISPDDIRIFLNLGKKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=59006 BALI_RS13255 WP_020452165.1 2712116..2712292(+) (sinI) [Bacillus paralicheniformis ATCC 9945a]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGACGATATACGTATTTTTCTCAATTTGGGTAAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5


Multiple sequence alignment