Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   KXY09_RS02050 Genome accession   NZ_CP079719
Coordinates   406949..407068 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain LABIM44     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 401949..412068
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KXY09_RS02035 (KXY09_02035) - 403561..404244 (+) 684 WP_160242544.1 response regulator transcription factor -
  KXY09_RS02040 (KXY09_02040) - 404231..405664 (+) 1434 WP_162992601.1 HAMP domain-containing sensor histidine kinase -
  KXY09_RS02045 (KXY09_02045) rapC 405817..406965 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  KXY09_RS02050 (KXY09_02050) phrC 406949..407068 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  KXY09_RS02055 (KXY09_02055) - 407217..407327 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  KXY09_RS02060 (KXY09_02060) - 407407..408771 (-) 1365 WP_136396097.1 aspartate kinase -
  KXY09_RS02065 (KXY09_02065) ceuB 409185..410138 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  KXY09_RS02070 (KXY09_02070) - 410128..411075 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  KXY09_RS02075 (KXY09_02075) - 411069..411827 (+) 759 WP_063096189.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=588878 KXY09_RS02050 WP_003156334.1 406949..407068(+) (phrC) [Bacillus velezensis strain LABIM44]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=588878 KXY09_RS02050 WP_003156334.1 406949..407068(+) (phrC) [Bacillus velezensis strain LABIM44]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718