Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   K749_RS03995 Genome accession   NC_021216
Coordinates   813452..813577 (+) Length   41 a.a.
NCBI ID   WP_020849792.1    Uniprot ID   -
Organism   Helicobacter pylori UM299     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 808452..818577
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K749_RS03970 (K749_06995) - 808512..810734 (+) 2223 WP_015645811.1 ATP-dependent Clp protease ATP-binding subunit -
  K749_RS03975 (K749_07000) panD 810724..811074 (+) 351 WP_015645812.1 aspartate 1-decarboxylase -
  K749_RS03980 (K749_07005) - 811085..811378 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  K749_RS03985 (K749_07010) - 811378..812373 (+) 996 WP_015645813.1 PDZ domain-containing protein -
  K749_RS03990 (K749_07015) comB6 812381..813436 (+) 1056 WP_015645814.1 P-type conjugative transfer protein TrbL Machinery gene
  K749_RS03995 comB7 813452..813577 (+) 126 WP_020849792.1 hypothetical protein Machinery gene
  K749_RS04000 (K749_07020) comB8 813574..814317 (+) 744 WP_015645815.1 virB8 family protein Machinery gene
  K749_RS04005 (K749_07025) comB9 814317..815312 (+) 996 WP_015645816.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  K749_RS04010 (K749_07030) comB10 815305..816441 (+) 1137 WP_015645817.1 DNA type IV secretion system protein ComB10 Machinery gene
  K749_RS04015 (K749_07035) - 816507..817919 (+) 1413 WP_015645818.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4699.69 Da        Isoelectric Point: 8.5447

>NTDB_id=58703 K749_RS03995 WP_020849792.1 813452..813577(+) (comB7) [Helicobacter pylori UM299]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENGLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=58703 K749_RS03995 WP_020849792.1 813452..813577(+) (comB7) [Helicobacter pylori UM299]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACGGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854

Multiple sequence alignment