Detailed information
Bioinformatically predicted
Overview
| Name | comE | Type | Machinery gene |
| Locus tag | KWY94_RS10885 | Genome accession | NZ_CP078113 |
| Coordinates | 2084888..2085283 (-) | Length | 131 a.a. |
| NCBI ID | WP_003703428.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain O2D156 | ||
| Function | DNA binding (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2050417..2084102 | 2084888..2085283 | flank | 786 |
Gene organization within MGE regions
Location: 2050417..2085283
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KWY94_RS10630 (KWY94_10630) | - | 2050445..2051419 (-) | 975 | WP_003689550.1 | SIS domain-containing protein | - |
| KWY94_RS10635 (KWY94_10635) | tal | 2051516..2052571 (+) | 1056 | WP_003695503.1 | transaldolase | - |
| KWY94_RS11805 | - | 2052583..2052717 (+) | 135 | WP_256263212.1 | hypothetical protein | - |
| KWY94_RS10640 (KWY94_10640) | - | 2052722..2053012 (+) | 291 | WP_003689553.1 | hypothetical protein | - |
| KWY94_RS10645 (KWY94_10645) | gluQRS | 2053029..2053916 (+) | 888 | WP_003689554.1 | tRNA glutamyl-Q(34) synthetase GluQRS | - |
| KWY94_RS10650 (KWY94_10650) | dusA | 2053986..2055002 (-) | 1017 | WP_003689555.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| KWY94_RS10655 (KWY94_10655) | - | 2055122..2056276 (+) | 1155 | WP_003697468.1 | tyrosine-type recombinase/integrase | - |
| KWY94_RS10660 (KWY94_10660) | - | 2056326..2056592 (-) | 267 | WP_003689557.1 | pyocin activator PrtN family protein | - |
| KWY94_RS10665 (KWY94_10665) | - | 2056700..2057848 (-) | 1149 | WP_003705649.1 | hypothetical protein | - |
| KWY94_RS10670 (KWY94_10670) | - | 2057845..2058828 (-) | 984 | WP_082298685.1 | hypothetical protein | - |
| KWY94_RS10675 (KWY94_10675) | - | 2058939..2059154 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| KWY94_RS10680 (KWY94_10680) | - | 2059206..2059697 (-) | 492 | WP_003696912.1 | siphovirus Gp157 family protein | - |
| KWY94_RS10685 (KWY94_10685) | - | 2059694..2059876 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| KWY94_RS10690 (KWY94_10690) | - | 2060016..2060702 (-) | 687 | WP_218461093.1 | phage replication initiation protein, NGO0469 family | - |
| KWY94_RS10695 (KWY94_10695) | - | 2060771..2060932 (-) | 162 | WP_003693867.1 | hypothetical protein | - |
| KWY94_RS10700 (KWY94_10700) | - | 2060929..2061207 (-) | 279 | WP_144894338.1 | NGO1622 family putative holin | - |
| KWY94_RS10705 (KWY94_10705) | - | 2061360..2061692 (-) | 333 | WP_010357536.1 | hypothetical protein | - |
| KWY94_RS10710 (KWY94_10710) | - | 2061834..2062109 (-) | 276 | WP_047925817.1 | hypothetical protein | - |
| KWY94_RS10715 (KWY94_10715) | - | 2062106..2062582 (-) | 477 | WP_002255718.1 | hypothetical protein | - |
| KWY94_RS10720 (KWY94_10720) | - | 2062615..2062815 (-) | 201 | WP_003704298.1 | hypothetical protein | - |
| KWY94_RS10725 (KWY94_10725) | - | 2063036..2063797 (+) | 762 | WP_012503753.1 | hypothetical protein | - |
| KWY94_RS10730 (KWY94_10730) | - | 2063896..2064297 (-) | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| KWY94_RS10735 (KWY94_10735) | - | 2064399..2064581 (-) | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | - |
| KWY94_RS10740 (KWY94_10740) | - | 2064751..2065581 (-) | 831 | WP_003701455.1 | DUF3037 domain-containing protein | - |
| KWY94_RS10745 (KWY94_10745) | - | 2065566..2066264 (-) | 699 | WP_003689139.1 | HipA family kinase | - |
| KWY94_RS10750 (KWY94_10750) | - | 2066503..2067201 (-) | 699 | WP_002212401.1 | S24 family peptidase | - |
| KWY94_RS10755 (KWY94_10755) | - | 2067241..2067894 (-) | 654 | WP_157149898.1 | helix-turn-helix transcriptional regulator | - |
| KWY94_RS10760 (KWY94_10760) | - | 2068143..2068277 (+) | 135 | WP_229684436.1 | YdaS family helix-turn-helix protein | - |
| KWY94_RS10765 (KWY94_10765) | - | 2068279..2068479 (+) | 201 | WP_012503750.1 | hypothetical protein | - |
| KWY94_RS10770 (KWY94_10770) | - | 2068676..2069575 (+) | 900 | WP_218461094.1 | replication protein | - |
| KWY94_RS10775 (KWY94_10775) | - | 2069587..2070366 (+) | 780 | WP_050302231.1 | ATP-binding protein | - |
| KWY94_RS10780 (KWY94_10780) | - | 2070436..2070666 (+) | 231 | WP_218461095.1 | hypothetical protein | - |
| KWY94_RS10785 (KWY94_10785) | - | 2070680..2071174 (+) | 495 | WP_115067539.1 | DUF3310 domain-containing protein | - |
| KWY94_RS10790 (KWY94_10790) | - | 2071351..2071500 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| KWY94_RS11810 | - | 2071529..2071810 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| KWY94_RS10795 (KWY94_10795) | - | 2071801..2072181 (+) | 381 | WP_033910829.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KWY94_RS10800 (KWY94_10800) | - | 2072510..2073472 (-) | 963 | WP_218461081.1 | transposase | - |
| KWY94_RS10805 (KWY94_10805) | - | 2073985..2074344 (-) | 360 | WP_003691563.1 | hypothetical protein | - |
| KWY94_RS10810 (KWY94_10810) | - | 2074465..2075550 (-) | 1086 | WP_047922971.1 | zonular occludens toxin domain-containing protein | - |
| KWY94_RS10815 (KWY94_10815) | - | 2075560..2075850 (-) | 291 | WP_003689734.1 | DUF2523 domain-containing protein | - |
| KWY94_RS10820 (KWY94_10820) | - | 2075851..2077419 (-) | 1569 | WP_218461079.1 | IgG-binding virulence factor TspB family protein | - |
| KWY94_RS10825 (KWY94_10825) | - | 2077361..2077679 (-) | 319 | Protein_2111 | DUF1132 family protein | - |
| KWY94_RS10830 (KWY94_10830) | - | 2077807..2078085 (-) | 279 | WP_003691583.1 | hypothetical protein | - |
| KWY94_RS10835 (KWY94_10835) | - | 2078092..2078310 (-) | 219 | WP_003691584.1 | major capsid protein | - |
| KWY94_RS10840 (KWY94_10840) | - | 2078384..2078581 (-) | 198 | WP_003689600.1 | hypothetical protein | - |
| KWY94_RS10845 (KWY94_10845) | - | 2078586..2078876 (-) | 291 | WP_012503914.1 | hypothetical protein | - |
| KWY94_RS10850 (KWY94_10850) | - | 2078921..2080271 (-) | 1351 | Protein_2116 | replication initiation factor domain-containing protein | - |
| KWY94_RS10855 (KWY94_10855) | - | 2080410..2080832 (-) | 423 | WP_003691751.1 | very short patch repair endonuclease | - |
| KWY94_RS11815 | - | 2080838..2081434 (-) | 597 | WP_012503916.1 | TIGR02391 family protein | - |
| KWY94_RS11820 | - | 2081624..2082481 (-) | 858 | WP_012503917.1 | ATP-binding protein | - |
| KWY94_RS10865 (KWY94_10865) | - | 2082495..2082866 (-) | 372 | WP_012503918.1 | DNA cytosine methyltransferase | - |
| KWY94_RS10870 (KWY94_10870) | - | 2082863..2083453 (-) | 591 | WP_080229150.1 | DNA cytosine methyltransferase | - |
| KWY94_RS10875 (KWY94_10875) | - | 2083828..2083974 (+) | 147 | WP_003691757.1 | hypothetical protein | - |
| KWY94_RS10880 (KWY94_10880) | comP | 2084351..2084800 (-) | 450 | WP_002214937.1 | type IV pilin protein | Machinery gene |
| KWY94_RS10885 (KWY94_10885) | comE | 2084888..2085283 (-) | 396 | WP_003703428.1 | helix-hairpin-helix domain-containing protein | Machinery gene |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 13796.61 Da Isoelectric Point: 10.8790
>NTDB_id=586860 KWY94_RS10885 WP_003703428.1 2084888..2085283(-) (comE) [Neisseria gonorrhoeae strain O2D156]
MSRGGATPYRFLLIRHIVARCGLLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINAASQQELEALPGIGPAKAKAIAEY
RAQNGAFKSVDDLIKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPAVKK
MSRGGATPYRFLLIRHIVARCGLLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINAASQQELEALPGIGPAKAKAIAEY
RAQNGAFKSVDDLIKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPAVKK
Nucleotide
Download Length: 396 bp
>NTDB_id=586860 KWY94_RS10885 WP_003703428.1 2084888..2085283(-) (comE) [Neisseria gonorrhoeae strain O2D156]
TTGAGCCGGGGCGGGGCAACGCCGTACCGGTTTTTGTTAATCCGCCATATCGTCGCAAGATGCGGTTTGTTGTTTGCAAC
CCTTAAAGGAAAAACCATGAAAAAAATGTTTGTATTGTTCTGTATGCTGTTCTCCTGCGCCTTCTCCCTTGCGGCGGTAA
ACATCAATGCGGCTTCGCAGCAGGAGCTGGAGGCGCTGCCGGGCATAGGCCCGGCGAAGGCGAAGGCCATTGCGGAATAC
CGCGCGCAAAACGGCGCGTTCAAGTCTGTGGACGATTTGATCAAGGTGAAGGGCATCGGTCCGGCGGTGCTGGCGAAGCT
GAAAGACCAGGCTTCCGTCGGCGCGCCCGCACCAAAAGGCCCCGCCAAACCGGTGCTGCCTGCGGTTAAAAAATAG
TTGAGCCGGGGCGGGGCAACGCCGTACCGGTTTTTGTTAATCCGCCATATCGTCGCAAGATGCGGTTTGTTGTTTGCAAC
CCTTAAAGGAAAAACCATGAAAAAAATGTTTGTATTGTTCTGTATGCTGTTCTCCTGCGCCTTCTCCCTTGCGGCGGTAA
ACATCAATGCGGCTTCGCAGCAGGAGCTGGAGGCGCTGCCGGGCATAGGCCCGGCGAAGGCGAAGGCCATTGCGGAATAC
CGCGCGCAAAACGGCGCGTTCAAGTCTGTGGACGATTTGATCAAGGTGAAGGGCATCGGTCCGGCGGTGCTGGCGAAGCT
GAAAGACCAGGCTTCCGTCGGCGCGCCCGCACCAAAAGGCCCCGCCAAACCGGTGCTGCCTGCGGTTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comE | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| comE | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| comE | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| comE | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |