Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   KU527_RS13660 Genome accession   NZ_CP077908
Coordinates   2757682..2758119 (+) Length   145 a.a.
NCBI ID   WP_225806344.1    Uniprot ID   -
Organism   Staphylococcus aureus strain 322     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2747669..2764170 2757682..2758119 within 0


Gene organization within MGE regions


Location: 2747669..2764170
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KU527_RS13570 (KU527_13535) sufB 2747669..2749066 (+) 1398 WP_001074405.1 Fe-S cluster assembly protein SufB -
  KU527_RS13575 (KU527_13540) - 2749134..2750183 (-) 1050 WP_001145726.1 tyrosine-type recombinase/integrase -
  KU527_RS13580 (KU527_13545) - 2750296..2750475 (+) 180 WP_000337826.1 hypothetical protein -
  KU527_RS13585 (KU527_13550) - 2750455..2751387 (-) 933 WP_000392186.1 hypothetical protein -
  KU527_RS13590 (KU527_13555) - 2751419..2752144 (-) 726 WP_000661437.1 PH domain-containing protein -
  KU527_RS13595 (KU527_13560) - 2752172..2752846 (-) 675 WP_000775187.1 ImmA/IrrE family metallo-endopeptidase -
  KU527_RS13600 (KU527_13565) - 2752863..2753195 (-) 333 WP_001055143.1 helix-turn-helix domain-containing protein -
  KU527_RS13605 (KU527_13570) - 2753458..2753652 (+) 195 WP_000108122.1 helix-turn-helix domain-containing protein -
  KU527_RS13610 (KU527_13575) - 2753652..2754416 (+) 765 WP_001002759.1 phage antirepressor Ant -
  KU527_RS13615 (KU527_13580) - 2754433..2754627 (+) 195 WP_001148854.1 hypothetical protein -
  KU527_RS13620 (KU527_13585) - 2754658..2754801 (+) 144 WP_000939503.1 hypothetical protein -
  KU527_RS13625 (KU527_13590) - 2754822..2755379 (-) 558 WP_000388992.1 hypothetical protein -
  KU527_RS13630 (KU527_13595) - 2755450..2755671 (+) 222 WP_000977381.1 hypothetical protein -
  KU527_RS13635 (KU527_13600) - 2755664..2755825 (+) 162 WP_000066011.1 DUF1270 domain-containing protein -
  KU527_RS13640 (KU527_13605) - 2755918..2756220 (+) 303 WP_000165363.1 DUF2482 family protein -
  KU527_RS13645 (KU527_13610) - 2756225..2756485 (+) 261 WP_000291067.1 DUF1108 family protein -
  KU527_RS13650 (KU527_13615) - 2756498..2757034 (+) 537 WP_001004336.1 host-nuclease inhibitor Gam family protein -
  KU527_RS13655 (KU527_13620) - 2757035..2757685 (+) 651 WP_000840496.1 ERF family protein -
  KU527_RS13660 (KU527_13625) ssbA 2757682..2758119 (+) 438 WP_225806344.1 single-stranded DNA-binding protein Machinery gene
  KU527_RS13665 (KU527_13630) - 2758131..2758805 (+) 675 WP_000057261.1 putative HNHc nuclease -
  KU527_RS13670 (KU527_13635) - 2758802..2758951 (+) 150 WP_001622139.1 hypothetical protein -
  KU527_RS13675 (KU527_13640) - 2758944..2759225 (-) 282 WP_000414755.1 hypothetical protein -
  KU527_RS13680 (KU527_13645) - 2759291..2760061 (+) 771 WP_000190253.1 conserved phage C-terminal domain-containing protein -
  KU527_RS13685 (KU527_13650) - 2760071..2760850 (+) 780 WP_000803062.1 ATP-binding protein -
  KU527_RS13690 (KU527_13655) - 2760844..2761002 (+) 159 WP_000256589.1 hypothetical protein -
  KU527_RS13695 (KU527_13660) - 2761015..2761236 (+) 222 WP_001123695.1 DUF3269 family protein -
  KU527_RS13700 (KU527_13665) - 2761246..2761650 (+) 405 WP_000049795.1 DUF1064 domain-containing protein -
  KU527_RS13705 (KU527_13670) - 2761655..2761843 (+) 189 WP_020808085.1 DUF3113 family protein -
  KU527_RS13710 (KU527_13675) - 2761844..2762203 (+) 360 WP_001622141.1 SA1788 family PVL leukocidin-associated protein -
  KU527_RS13715 (KU527_13680) - 2762204..2762452 (+) 249 WP_001622142.1 phi PVL orf 51-like protein -
  KU527_RS13720 (KU527_13685) - 2762467..2762721 (+) 255 WP_001661914.1 DUF1024 family protein -
  KU527_RS13725 (KU527_13690) - 2762708..2762878 (+) 171 WP_000714412.1 hypothetical protein -
  KU527_RS13730 (KU527_13695) - 2762871..2763404 (+) 534 WP_015984502.1 dUTP diphosphatase -
  KU527_RS13735 (KU527_13700) - 2763459..2763614 (+) 156 WP_078368224.1 hypothetical protein -
  KU527_RS13740 (KU527_13705) - 2763631..2763819 (+) 189 WP_225806343.1 DUF1381 domain-containing protein -
  KU527_RS13745 (KU527_13710) - 2763794..2763994 (+) 201 WP_001125015.1 hypothetical protein -
  KU527_RS13750 (KU527_13715) rinB 2763997..2764170 (+) 174 WP_025174872.1 transcriptional activator RinB -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16180.76 Da        Isoelectric Point: 5.8347

>NTDB_id=584888 KU527_RS13660 WP_225806344.1 2757682..2758119(+) (ssbA) [Staphylococcus aureus strain 322]
MNTVNLIGNLVADPELKGQNNNLVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNTPQNRQQSNNPFANGPIEISDDDLPF

Nucleotide


Download         Length: 438 bp        

>NTDB_id=584888 KU527_RS13660 WP_225806344.1 2757682..2758119(+) (ssbA) [Staphylococcus aureus strain 322]
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACTTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACACACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
GTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

38.889

100

0.483

  ssb Latilactobacillus sakei subsp. sakei 23K

38.235

100

0.448