Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KU503_RS04040 | Genome accession | NZ_CP077898 |
| Coordinates | 820352..820789 (+) | Length | 145 a.a. |
| NCBI ID | WP_225806344.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 327 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 810339..854836 | 820352..820789 | within | 0 |
Gene organization within MGE regions
Location: 810339..854836
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KU503_RS03950 (KU503_03930) | sufB | 810339..811736 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| KU503_RS03955 (KU503_03935) | - | 811804..812853 (-) | 1050 | WP_001145726.1 | tyrosine-type recombinase/integrase | - |
| KU503_RS03960 (KU503_03940) | - | 812966..813145 (+) | 180 | WP_000337826.1 | hypothetical protein | - |
| KU503_RS03965 (KU503_03945) | - | 813125..814057 (-) | 933 | WP_000392186.1 | hypothetical protein | - |
| KU503_RS03970 (KU503_03950) | - | 814089..814814 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| KU503_RS03975 (KU503_03955) | - | 814842..815516 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KU503_RS03980 (KU503_03960) | - | 815533..815865 (-) | 333 | WP_001055143.1 | helix-turn-helix domain-containing protein | - |
| KU503_RS03985 (KU503_03965) | - | 816128..816322 (+) | 195 | WP_000108122.1 | helix-turn-helix domain-containing protein | - |
| KU503_RS03990 (KU503_03970) | - | 816322..817086 (+) | 765 | WP_001002759.1 | phage antirepressor Ant | - |
| KU503_RS03995 (KU503_03975) | - | 817103..817297 (+) | 195 | WP_001148854.1 | hypothetical protein | - |
| KU503_RS04000 (KU503_03980) | - | 817328..817471 (+) | 144 | WP_000939503.1 | hypothetical protein | - |
| KU503_RS04005 (KU503_03985) | - | 817492..818049 (-) | 558 | WP_000388992.1 | hypothetical protein | - |
| KU503_RS04010 (KU503_03990) | - | 818120..818341 (+) | 222 | WP_000977381.1 | hypothetical protein | - |
| KU503_RS04015 (KU503_03995) | - | 818334..818495 (+) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| KU503_RS04020 (KU503_04000) | - | 818588..818890 (+) | 303 | WP_000165363.1 | DUF2482 family protein | - |
| KU503_RS04025 (KU503_04005) | - | 818895..819155 (+) | 261 | WP_000291067.1 | DUF1108 family protein | - |
| KU503_RS04030 (KU503_04010) | - | 819168..819704 (+) | 537 | WP_001004336.1 | host-nuclease inhibitor Gam family protein | - |
| KU503_RS04035 (KU503_04015) | - | 819705..820355 (+) | 651 | WP_000840496.1 | ERF family protein | - |
| KU503_RS04040 (KU503_04020) | ssbA | 820352..820789 (+) | 438 | WP_225806344.1 | single-stranded DNA-binding protein | Machinery gene |
| KU503_RS04045 (KU503_04025) | - | 820801..821475 (+) | 675 | WP_000057261.1 | putative HNHc nuclease | - |
| KU503_RS04050 (KU503_04030) | - | 821472..821621 (+) | 150 | WP_001622139.1 | hypothetical protein | - |
| KU503_RS04055 (KU503_04035) | - | 821614..821895 (-) | 282 | WP_000414755.1 | hypothetical protein | - |
| KU503_RS04060 (KU503_04040) | - | 821961..822731 (+) | 771 | WP_000190253.1 | conserved phage C-terminal domain-containing protein | - |
| KU503_RS04065 (KU503_04045) | - | 822741..823520 (+) | 780 | WP_000803062.1 | ATP-binding protein | - |
| KU503_RS04070 (KU503_04050) | - | 823514..823672 (+) | 159 | WP_000256589.1 | hypothetical protein | - |
| KU503_RS04075 (KU503_04055) | - | 823685..823906 (+) | 222 | WP_001123695.1 | DUF3269 family protein | - |
| KU503_RS04080 (KU503_04060) | - | 823916..824320 (+) | 405 | WP_000049795.1 | DUF1064 domain-containing protein | - |
| KU503_RS04085 (KU503_04065) | - | 824325..824513 (+) | 189 | WP_020808085.1 | DUF3113 family protein | - |
| KU503_RS04090 (KU503_04070) | - | 824514..824873 (+) | 360 | WP_001622141.1 | SA1788 family PVL leukocidin-associated protein | - |
| KU503_RS04095 (KU503_04075) | - | 824874..825122 (+) | 249 | WP_001622142.1 | phi PVL orf 51-like protein | - |
| KU503_RS04100 (KU503_04080) | - | 825137..825391 (+) | 255 | WP_001661914.1 | DUF1024 family protein | - |
| KU503_RS04105 (KU503_04085) | - | 825378..825548 (+) | 171 | WP_000714412.1 | hypothetical protein | - |
| KU503_RS04110 (KU503_04090) | - | 825541..826074 (+) | 534 | WP_015984502.1 | dUTP diphosphatase | - |
| KU503_RS04115 (KU503_04095) | - | 826129..826284 (+) | 156 | WP_078368224.1 | hypothetical protein | - |
| KU503_RS04120 (KU503_04100) | - | 826301..826489 (+) | 189 | WP_225806343.1 | DUF1381 domain-containing protein | - |
| KU503_RS04125 (KU503_04105) | - | 826464..826664 (+) | 201 | WP_001125015.1 | hypothetical protein | - |
| KU503_RS04130 (KU503_04110) | rinB | 826667..826840 (+) | 174 | WP_025174872.1 | transcriptional activator RinB | - |
| KU503_RS04135 (KU503_04115) | - | 826841..826987 (+) | 147 | WP_000990007.1 | hypothetical protein | - |
| KU503_RS04140 (KU503_04120) | - | 827002..827421 (+) | 420 | WP_000058632.1 | transcriptional regulator | - |
| KU503_RS04145 (KU503_04125) | - | 827608..828048 (+) | 441 | WP_001566315.1 | terminase small subunit | - |
| KU503_RS04150 (KU503_04130) | - | 828035..829312 (+) | 1278 | WP_000169946.1 | PBSX family phage terminase large subunit | - |
| KU503_RS04155 (KU503_04135) | - | 829323..830861 (+) | 1539 | WP_225806342.1 | phage portal protein | - |
| KU503_RS04160 (KU503_04140) | - | 830868..831863 (+) | 996 | WP_225806341.1 | minor capsid protein | - |
| KU503_RS04165 (KU503_04145) | - | 831936..832106 (+) | 171 | WP_000072208.1 | hypothetical protein | - |
| KU503_RS04170 | - | 832134..832221 (+) | 88 | Protein_816 | hypothetical protein | - |
| KU503_RS04175 (KU503_04150) | - | 832215..832835 (+) | 621 | WP_000392143.1 | DUF4355 domain-containing protein | - |
| KU503_RS04180 (KU503_04155) | - | 832849..833823 (+) | 975 | WP_225806340.1 | phage major capsid protein | - |
| KU503_RS04185 (KU503_04160) | - | 833845..834132 (+) | 288 | WP_001114086.1 | hypothetical protein | - |
| KU503_RS04190 (KU503_04165) | - | 834141..834473 (+) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| KU503_RS04195 (KU503_04170) | - | 834470..834772 (+) | 303 | WP_001268313.1 | hypothetical protein | - |
| KU503_RS04200 (KU503_04175) | - | 834772..835119 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| KU503_RS04205 (KU503_04180) | - | 835131..835514 (+) | 384 | WP_000188643.1 | hypothetical protein | - |
| KU503_RS04210 (KU503_04185) | - | 835533..836114 (+) | 582 | WP_000002577.1 | phage major tail protein, TP901-1 family | - |
| KU503_RS04215 (KU503_04190) | - | 836176..836541 (+) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| KU503_RS04220 (KU503_04195) | - | 836571..836915 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| KU503_RS04225 (KU503_04200) | - | 836932..840399 (+) | 3468 | WP_225806339.1 | hypothetical protein | - |
| KU503_RS04230 (KU503_04205) | - | 840412..841359 (+) | 948 | WP_000350675.1 | phage tail family protein | - |
| KU503_RS04235 (KU503_04210) | - | 841368..843266 (+) | 1899 | WP_000152718.1 | SGNH/GDSL hydrolase family protein | - |
| KU503_RS04240 (KU503_04215) | - | 843281..845191 (+) | 1911 | WP_001836235.1 | hypothetical protein | - |
| KU503_RS04245 (KU503_04220) | - | 845191..847014 (+) | 1824 | WP_016170469.1 | phage baseplate upper protein | - |
| KU503_RS04250 (KU503_04225) | - | 847014..847391 (+) | 378 | WP_000705896.1 | DUF2977 domain-containing protein | - |
| KU503_RS04255 (KU503_04230) | - | 847395..847568 (+) | 174 | WP_000782200.1 | XkdX family protein | - |
| KU503_RS04260 (KU503_04235) | - | 847608..847907 (+) | 300 | WP_000466777.1 | DUF2951 domain-containing protein | - |
| KU503_RS04265 (KU503_04240) | - | 848044..849942 (+) | 1899 | WP_162649088.1 | N-acetylglucosaminidase | - |
| KU503_RS04270 (KU503_04245) | - | 849955..851193 (+) | 1239 | WP_016170467.1 | BppU family phage baseplate upper protein | - |
| KU503_RS04275 (KU503_04250) | - | 851199..851594 (+) | 396 | WP_016170466.1 | hypothetical protein | - |
| KU503_RS04280 (KU503_04255) | - | 851650..851925 (+) | 276 | WP_000351119.1 | phage holin | - |
| KU503_RS04285 (KU503_04260) | - | 851912..853324 (+) | 1413 | WP_001141517.1 | N-acetylmuramoyl-L-alanine amidase | - |
| KU503_RS04290 (KU503_04265) | - | 853384..853941 (-) | 558 | WP_001035620.1 | DUF4888 domain-containing protein | - |
| KU503_RS04295 (KU503_04270) | - | 854316..854468 (+) | 153 | WP_078370103.1 | hypothetical protein | - |
| KU503_RS04300 (KU503_04275) | - | 854539..854649 (+) | 111 | WP_000139423.1 | hypothetical protein | - |
| KU503_RS04305 (KU503_04280) | - | 854651..854836 (+) | 186 | WP_001286805.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 16180.76 Da Isoelectric Point: 5.8347
>NTDB_id=584768 KU503_RS04040 WP_225806344.1 820352..820789(+) (ssbA) [Staphylococcus aureus strain 327]
MNTVNLIGNLVADPELKGQNNNLVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNTPQNRQQSNNPFANGPIEISDDDLPF
MNTVNLIGNLVADPELKGQNNNLVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNTPQNRQQSNNPFANGPIEISDDDLPF
Nucleotide
Download Length: 438 bp
>NTDB_id=584768 KU503_RS04040 WP_225806344.1 820352..820789(+) (ssbA) [Staphylococcus aureus strain 327]
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACTTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACACACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
GTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACTTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACACACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
GTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
38.889 |
100 |
0.483 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
38.235 |
100 |
0.448 |