Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KTT68_RS14710 Genome accession   NZ_CP077672
Coordinates   3017749..3017889 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SWUJ1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3012749..3022889
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KTT68_RS14685 - 3013063..3013446 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  KTT68_RS14690 comA 3013468..3014112 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  KTT68_RS14695 comP 3014193..3016544 (-) 2352 WP_275424139.1 sensor histidine kinase Regulator
  KTT68_RS14700 comX 3016522..3016692 (-) 171 WP_045208751.1 competence pheromone ComX -
  KTT68_RS14705 - 3016689..3017618 (-) 930 WP_224223773.1 polyprenyl synthetase family protein -
  KTT68_RS14710 degQ 3017749..3017889 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  KTT68_RS14715 - 3018355..3018696 (+) 342 WP_007613435.1 hypothetical protein -
  KTT68_RS14720 - 3018703..3019926 (-) 1224 WP_007613436.1 EAL and HDOD domain-containing protein -
  KTT68_RS14725 - 3020056..3021522 (-) 1467 WP_224223774.1 nicotinate phosphoribosyltransferase -
  KTT68_RS14730 - 3021540..3022091 (-) 552 WP_224223775.1 cysteine hydrolase family protein -
  KTT68_RS14735 - 3022188..3022586 (-) 399 WP_082998524.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=582098 KTT68_RS14710 WP_003152043.1 3017749..3017889(-) (degQ) [Bacillus velezensis strain SWUJ1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=582098 KTT68_RS14710 WP_003152043.1 3017749..3017889(-) (degQ) [Bacillus velezensis strain SWUJ1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891