Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   KTT68_RS01985 Genome accession   NZ_CP077672
Coordinates   391858..391977 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain SWUJ1     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 386858..396977
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KTT68_RS01970 - 388470..389153 (+) 684 WP_007609386.1 response regulator transcription factor -
  KTT68_RS01975 - 389140..390567 (+) 1428 WP_224224030.1 HAMP domain-containing sensor histidine kinase -
  KTT68_RS01980 rapC 390726..391874 (+) 1149 WP_029326229.1 Rap family tetratricopeptide repeat protein Regulator
  KTT68_RS01985 phrC 391858..391977 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  KTT68_RS01990 - 392126..392236 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  KTT68_RS01995 - 392316..393680 (-) 1365 WP_020955323.1 aspartate kinase -
  KTT68_RS02000 ceuB 394094..395047 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  KTT68_RS02005 - 395037..395984 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  KTT68_RS02010 - 395978..396736 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=582049 KTT68_RS01985 WP_003156334.1 391858..391977(+) (phrC) [Bacillus velezensis strain SWUJ1]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=582049 KTT68_RS01985 WP_003156334.1 391858..391977(+) (phrC) [Bacillus velezensis strain SWUJ1]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718