Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   SPN994039_RS02610 Genome accession   NC_021005
Coordinates   485617..485766 (+) Length   49 a.a.
NCBI ID   WP_001808912.1    Uniprot ID   A0A4J1ZTW6
Organism   Streptococcus pneumoniae SPN994039     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 475127..484671 485617..485766 flank 946


Gene organization within MGE regions


Location: 475127..485766
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPN994039_RS02545 (SPN994039_04720) - 475127..475414 (-) 288 WP_000777760.1 hypothetical protein -
  SPN994039_RS02550 (SPN994039_04730) - 475424..475834 (-) 411 WP_001278301.1 HIT family protein -
  SPN994039_RS02555 (SPN994039_04740) pptA 475902..476633 (+) 732 WP_000889923.1 ABC transporter ATP-binding protein Regulator
  SPN994039_RS02560 (SPN994039_04750) - 476630..477679 (+) 1050 WP_000653752.1 ABC transporter permease -
  SPN994039_RS02565 (SPN994039_04760) - 477847..478176 (-) 330 WP_000132570.1 hypothetical protein -
  SPN994039_RS02570 (SPN994039_04770) - 478452..478790 (+) 339 WP_000682119.1 LytTR family DNA-binding domain-containing protein -
  SPN994039_RS02575 (SPN994039_04780) comE/blpR 478795..479532 (+) 738 WP_001219127.1 response regulator transcription factor Regulator
  SPN994039_RS02580 (SPN994039_04790) - 479546..480886 (+) 1341 WP_001017622.1 sensor histidine kinase -
  SPN994039_RS02585 (SPN994039_04800) blpC 480928..481083 (-) 156 WP_000358813.1 quorum-sensing system pheromone BlpC -
  SPN994039_RS02590 (SPN994039_04810) - 481140..482501 (-) 1362 WP_001069092.1 bacteriocin secretion accessory protein -
  SPN994039_RS13305 comA/nlmT 482512..483000 (-) 489 WP_307774349.1 ATP-binding cassette domain-containing protein Regulator
  SPN994039_RS13310 comA/nlmT 482984..483424 (-) 441 WP_001808911.1 ATP-binding cassette domain-containing protein Regulator
  SPN994039_RS13315 comA/nlmT 483414..484139 (-) 726 WP_167750760.1 ABC transporter transmembrane domain-containing protein Regulator
  SPN994039_RS13320 (SPN994039_04830) comA/nlmT 484084..484671 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  SPN994039_RS02605 (SPN994039_04840) blpI 484953..485150 (+) 198 WP_001093258.1 bacteriocin-like peptide BlpI -
  SPN994039_RS02610 cipB 485617..485766 (+) 150 WP_001808912.1 bacteriocin-like peptide BlpO Regulator

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5150.86 Da        Isoelectric Point: 3.7098

>NTDB_id=57927 SPN994039_RS02610 WP_001808912.1 485617..485766(+) (cipB) [Streptococcus pneumoniae SPN994039]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=57927 SPN994039_RS02610 WP_001808912.1 485617..485766(+) (cipB) [Streptococcus pneumoniae SPN994039]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A4J1ZTW6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51


Multiple sequence alignment