Detailed information    

insolico Bioinformatically predicted

Overview


Name   dprA   Type   Machinery gene
Locus tag   KQY23_RS05865 Genome accession   NZ_CP076823
Coordinates   1223765..1224637 (+) Length   290 a.a.
NCBI ID   WP_000620183.1    Uniprot ID   A0A6B1RG35
Organism   Staphylococcus aureus strain ST59     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1196749..1266982 1223765..1224637 within 0


Gene organization within MGE regions


Location: 1196749..1266982
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KQY23_RS05750 (KQY23_05750) fakA 1196921..1198567 (+) 1647 WP_057504507.1 fatty acid kinase catalytic subunit FakA -
  KQY23_RS05755 (KQY23_05755) recG 1198757..1200817 (+) 2061 WP_001151491.1 ATP-dependent DNA helicase RecG -
  KQY23_RS05760 (KQY23_05760) fapR 1201019..1201591 (+) 573 WP_001548538.1 transcription factor FapR -
  KQY23_RS05765 (KQY23_05765) plsX 1201596..1202582 (+) 987 WP_000239738.1 phosphate acyltransferase PlsX -
  KQY23_RS05770 (KQY23_05770) fabD 1202575..1203501 (+) 927 WP_001043838.1 ACP S-malonyltransferase -
  KQY23_RS05775 (KQY23_05775) fabG 1203494..1204228 (+) 735 WP_000167269.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  KQY23_RS05780 (KQY23_05780) - 1204534..1204767 (+) 234 WP_000426914.1 acyl carrier protein -
  KQY23_RS05785 (KQY23_05785) rnc 1204883..1205614 (+) 732 WP_000043237.1 ribonuclease III -
  KQY23_RS05790 (KQY23_05790) smc 1205761..1209327 (+) 3567 WP_000262685.1 chromosome segregation protein SMC -
  KQY23_RS05795 (KQY23_05795) ftsY 1209327..1210577 (+) 1251 WP_000007686.1 signal recognition particle-docking protein FtsY -
  KQY23_RS05800 (KQY23_05800) - 1210564..1210896 (+) 333 WP_000531320.1 putative DNA-binding protein -
  KQY23_RS05805 (KQY23_05805) ffh 1210922..1212289 (+) 1368 WP_216753105.1 signal recognition particle protein -
  KQY23_RS05810 (KQY23_05810) rpsP 1212635..1212910 (+) 276 WP_000268754.1 30S ribosomal protein S16 -
  KQY23_RS05815 (KQY23_05815) rimM 1213098..1213601 (+) 504 WP_001261990.1 ribosome maturation factor RimM -
  KQY23_RS05820 (KQY23_05820) trmD 1213601..1214338 (+) 738 WP_000687320.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  KQY23_RS05825 (KQY23_05825) rplS 1214441..1214791 (+) 351 WP_000181404.1 50S ribosomal protein L19 -
  KQY23_RS05830 (KQY23_05830) yfhO 1215035..1217641 (-) 2607 WP_000915249.1 lipoteichoic acid-specific glycosyltransferase YfhO -
  KQY23_RS05835 (KQY23_05835) ylqF 1218042..1218926 (+) 885 WP_000236718.1 ribosome biogenesis GTPase YlqF -
  KQY23_RS05840 (KQY23_05840) - 1218910..1219677 (+) 768 WP_000176399.1 ribonuclease HII -
  KQY23_RS05845 (KQY23_05845) sucC 1219786..1220952 (+) 1167 WP_001020801.1 ADP-forming succinate--CoA ligase subunit beta -
  KQY23_RS05850 (KQY23_05850) sucD 1220974..1221882 (+) 909 WP_000110253.1 succinate--CoA ligase subunit alpha -
  KQY23_RS05855 (KQY23_05855) - 1222169..1222321 (+) 153 Protein_1153 cell wall hydrolase -
  KQY23_RS05860 (KQY23_05860) fmhC 1222349..1223593 (+) 1245 WP_000672856.1 FemA/FemB family glycyltransferase FmhC -
  KQY23_RS05865 (KQY23_05865) dprA 1223765..1224637 (+) 873 WP_000620183.1 DNA-processing protein DprA Machinery gene
  KQY23_RS05870 (KQY23_05870) topA 1224810..1226885 (+) 2076 WP_001838647.1 type I DNA topoisomerase -
  KQY23_RS05875 (KQY23_05875) trmFO 1227041..1228348 (+) 1308 WP_000195254.1 methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO -
  KQY23_RS05880 (KQY23_05880) xerC 1228766..1229662 (+) 897 WP_001015609.1 tyrosine recombinase XerC -
  KQY23_RS05885 (KQY23_05885) hslV 1229659..1230204 (+) 546 WP_000072681.1 ATP-dependent protease subunit HslV -
  KQY23_RS05890 (KQY23_05890) hslU 1230270..1231673 (+) 1404 WP_000379054.1 ATP-dependent protease ATPase subunit HslU -
  KQY23_RS05895 (KQY23_05895) codY 1231698..1232471 (+) 774 WP_000055337.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  KQY23_RS05900 (KQY23_05900) - 1232522..1232614 (+) 93 WP_031788481.1 hypothetical protein -
  KQY23_RS05905 (KQY23_05905) rpsB 1232813..1233580 (+) 768 WP_000268484.1 30S ribosomal protein S2 -
  KQY23_RS05910 (KQY23_05910) - 1233614..1233727 (+) 114 WP_031845108.1 hypothetical protein -
  KQY23_RS05915 (KQY23_05915) tsf 1233762..1234643 (+) 882 WP_000201386.1 translation elongation factor Ts -
  KQY23_RS05920 (KQY23_05920) pyrH 1234780..1235502 (+) 723 WP_000057330.1 UMP kinase -
  KQY23_RS05925 (KQY23_05925) frr 1235521..1236075 (+) 555 WP_001280006.1 ribosome recycling factor -
  KQY23_RS05930 (KQY23_05930) - 1236448..1237218 (+) 771 WP_000473705.1 isoprenyl transferase -
  KQY23_RS05935 (KQY23_05935) - 1237225..1238007 (+) 783 WP_000868413.1 phosphatidate cytidylyltransferase -
  KQY23_RS05940 (KQY23_05940) rseP 1238219..1239505 (+) 1287 WP_000121121.1 RIP metalloprotease RseP -
  KQY23_RS05945 (KQY23_05945) - 1239525..1241228 (+) 1704 WP_000814107.1 proline--tRNA ligase -
  KQY23_RS05950 (KQY23_05950) - 1241492..1245802 (+) 4311 WP_078065168.1 PolC-type DNA polymerase III -
  KQY23_RS05955 (KQY23_05955) rimP 1246092..1246559 (+) 468 WP_000036631.1 ribosome maturation factor RimP -
  KQY23_RS05960 (KQY23_05960) nusA 1246581..1247756 (+) 1176 WP_000097463.1 transcription termination factor NusA -
  KQY23_RS05965 (KQY23_05965) - 1247777..1248061 (+) 285 WP_000727423.1 YlxR family RNase P modulator -
  KQY23_RS05970 (KQY23_05970) - 1248058..1248375 (+) 318 WP_000020853.1 YlxQ family RNA-binding protein -
  KQY23_RS05975 (KQY23_05975) infB 1248380..1250498 (+) 2119 Protein_1177 translation initiation factor IF-2 -
  KQY23_RS05980 (KQY23_05980) rbfA 1250885..1251235 (+) 351 WP_000097322.1 30S ribosome-binding factor RbfA -
  KQY23_RS05985 (KQY23_05985) truB 1251405..1252322 (+) 918 WP_000282295.1 tRNA pseudouridine(55) synthase TruB -
  KQY23_RS05990 (KQY23_05990) ribF 1252337..1253307 (+) 971 Protein_1180 riboflavin biosynthesis protein RibF -
  KQY23_RS05995 (KQY23_05995) rpsO 1253415..1253690 (+) 276 WP_216753107.1 30S ribosomal protein S15 -
  KQY23_RS06000 (KQY23_06000) pnp 1254052..1256154 (+) 2103 Protein_1182 polyribonucleotide nucleotidyltransferase -
  KQY23_RS06005 (KQY23_06005) - 1256390..1258062 (+) 1673 Protein_1183 ribonuclease J -
  KQY23_RS06010 (KQY23_06010) - 1258320..1260685 (+) 2366 Protein_1184 DNA translocase FtsK -
  KQY23_RS06015 (KQY23_06015) - 1260690..1261403 (+) 714 WP_001293310.1 GntR family transcriptional regulator -
  KQY23_RS06020 (KQY23_06020) - 1261434..1262700 (+) 1267 Protein_1186 M16 family metallopeptidase -
  KQY23_RS06025 (KQY23_06025) - 1262700..1263984 (+) 1285 Protein_1187 M16 family metallopeptidase -
  KQY23_RS06030 (KQY23_06030) - 1263984..1264690 (+) 707 Protein_1188 SDR family NAD(P)-dependent oxidoreductase -
  KQY23_RS06035 (KQY23_06035) - 1264795..1265622 (+) 828 WP_000214892.1 YmfK family protein -
  KQY23_RS06040 (KQY23_06040) - 1265641..1266033 (+) 393 WP_000859443.1 RodZ family helix-turn-helix domain-containing protein -
  KQY23_RS06045 (KQY23_06045) pgsA 1266067..1266645 (+) 579 WP_001025093.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -

Sequence


Protein


Download         Length: 290 a.a.        Molecular weight: 33532.95 Da        Isoelectric Point: 9.5191

>NTDB_id=578319 KQY23_RS05865 WP_000620183.1 1223765..1224637(+) (dprA) [Staphylococcus aureus strain ST59]
MIRLFLLKLYWAHFSTKQIHQFLMAYPNVIKEGGRKKDSYLCEWVNREENVHLLRKYYAFIKLDHNDIIKELQKLKVSYI
TYMDTEYPVLLKEIYQFPLLLFYKGNINLINNMHHLAVVGARDSTSYTQQSLEFLLSNDKSKYLTIVSGLAQGADAMAHQ
IALKYNLPTIAVLAFGHQIHYPKSTLALRNKIEEKGLVISEYPPHTPIAKYRFPERNRIISGLSKGVLITEAKEQSGSHI
TIDFALEQNRNVYVLPGSMFNPMTKGNLLRIQEGAKVVLNANDIFEDYYI

Nucleotide


Download         Length: 873 bp        

>NTDB_id=578319 KQY23_RS05865 WP_000620183.1 1223765..1224637(+) (dprA) [Staphylococcus aureus strain ST59]
TTGATTAGACTATTTTTGCTTAAGTTATACTGGGCACACTTTTCGACTAAACAAATTCATCAATTTTTAATGGCATATCC
TAATGTAATTAAAGAGGGGGGCAGAAAAAAAGATAGTTATTTATGTGAATGGGTGAATAGGGAAGAAAATGTTCATTTAT
TACGTAAATACTATGCTTTTATAAAACTTGATCATAACGATATTATTAAAGAACTGCAGAAATTAAAAGTAAGTTACATT
ACATATATGGATACTGAATACCCAGTGCTATTAAAAGAAATATATCAATTTCCATTACTTCTTTTCTATAAAGGGAACAT
AAATTTAATAAATAATATGCATCATTTGGCAGTAGTAGGTGCAAGAGATTCTACAAGTTATACCCAACAGTCTTTAGAAT
TTTTATTATCAAATGATAAAAGCAAATATTTAACAATTGTTTCCGGCCTTGCTCAAGGAGCTGATGCAATGGCACATCAA
ATAGCTTTAAAATACAATCTCCCTACAATAGCAGTTTTAGCCTTTGGCCATCAAATACATTATCCCAAAAGTACATTAGC
ATTAAGAAATAAAATAGAAGAAAAAGGTTTAGTTATATCCGAATATCCACCACATACACCAATTGCTAAATATAGATTTC
CTGAGCGCAATAGAATTATCAGCGGTTTGTCAAAAGGGGTTTTAATTACTGAGGCTAAGGAACAAAGTGGCAGTCACATC
ACGATAGATTTTGCATTAGAGCAAAATAGAAATGTTTATGTTTTACCTGGATCTATGTTTAATCCTATGACAAAAGGTAA
TTTATTACGTATCCAAGAAGGAGCTAAGGTAGTATTAAACGCTAATGATATATTTGAAGACTACTATATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6B1RG35

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus MW2

98.276

100

0.983

  dprA Staphylococcus aureus N315

97.931

100

0.979