Detailed information    

insolico Bioinformatically predicted

Overview


Name   comS   Type   Regulator
Locus tag   - Genome accession   NZ_KB904458
Coordinates   11715..11813 (-) Length   33 a.a.
NCBI ID   - Uniprot ID   -
Organism   Streptococcus orisratti DSM 15617     
Function   activate transcription of comX; activate transcription of comS (predicted from homology)   
Competence regulation

Genomic Context


Location: 6715..16813
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A3I7_RS0103645 - 7526..9313 (-) 1788 WP_018375426.1 acyltransferase family protein -
  A3I7_RS0103650 - 9310..9690 (-) 381 WP_018375427.1 membrane protein -
  A3I7_RS0103655 - 9708..10136 (-) 429 WP_018375428.1 low molecular weight protein-tyrosine-phosphatase -
  A3I7_RS0103660 ruvB 10427..11428 (-) 1002 WP_026217115.1 Holliday junction branch migration DNA helicase RuvB Machinery gene
  - comS 11715..11813 (-) 99 - - Regulator
  A3I7_RS0103670 comR 11893..12798 (-) 906 WP_018375431.1 helix-turn-helix domain-containing protein Regulator
  A3I7_RS14000 - 12875..13042 (-) 168 Protein_11 XRE family transcriptional regulator -
  A3I7_RS0103680 comR 13078..13989 (-) 912 WP_018375433.1 helix-turn-helix domain-containing protein Regulator
  A3I7_RS0103685 purB 14206..15504 (-) 1299 WP_018375434.1 adenylosuccinate lyase -

Sequence


Protein


Download         Length: 33 a.a.        Molecular weight: 4049.79 Da        Isoelectric Point: 10.3202

>NTDB_id=577 11715..11813(-) (comS) [Streptococcus orisratti DSM 15617]
MKNWKQYRLYLVLATAIFAKNANLLGDFFWWNL

Nucleotide


Download         Length: 99 bp        

>NTDB_id=577 11715..11813(-) (comS) [Streptococcus orisratti DSM 15617]
ATGAAAAATTGGAAACAATATCGACTTTATCTAGTTCTTGCGACAGCTATTTTTGCTAAGAATGCTAACTTACTAGGAGA
TTTCTTTTGGTGGAATCTT

XIP


This gene is known to encode the precursor of σX inducing peptide (XIP), which involves in competence development. The mature XIP sequence is displayed as below:

DFFWWNL


Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value