Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG61_RS00860 Genome accession   NZ_CP094148
Coordinates   184350..184463 (+) Length   37 a.a.
NCBI ID   WP_245020516.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe024     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 179350..189463
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG61_RS00835 (MPG61_00835) - 179417..181639 (+) 2223 WP_245020514.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG61_RS00840 (MPG61_00840) panD 181629..181982 (+) 354 WP_220925212.1 aspartate 1-decarboxylase -
  MPG61_RS00845 (MPG61_00845) - 181985..182278 (+) 294 WP_048944407.1 YbaB/EbfC family nucleoid-associated protein -
  MPG61_RS00850 (MPG61_00850) - 182278..183273 (+) 996 WP_245020787.1 PDZ domain-containing protein -
  MPG61_RS00855 (MPG61_00855) comB6 183279..184334 (+) 1056 WP_245020515.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG61_RS00860 (MPG61_00860) comB7 184350..184463 (+) 114 WP_245020516.1 comB7 lipoprotein Machinery gene
  MPG61_RS00865 (MPG61_00865) comB8 184460..185203 (+) 744 WP_000660524.1 virB8 family protein Machinery gene
  MPG61_RS00870 (MPG61_00870) comB9 185203..186165 (+) 963 WP_220925210.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG61_RS00875 (MPG61_00875) comB10 186158..187294 (+) 1137 WP_245020517.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG61_RS00880 (MPG61_00880) - 187364..188776 (+) 1413 WP_245020518.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4305.26 Da        Isoelectric Point: 9.3572

>NTDB_id=576314 MPG61_RS00860 WP_245020516.1 184350..184463(+) (comB7) [Helicobacter pylori strain Hpfe024]
MRIFFVIIGLMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=576314 MPG61_RS00860 WP_245020516.1 184350..184463(+) (comB7) [Helicobacter pylori strain Hpfe024]
ATGAGAATTTTTTTTGTTATTATTGGACTAATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919