Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KNV92_RS14550 Genome accession   NZ_CP076514
Coordinates   2980020..2980160 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain WB     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2975020..2985160
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KNV92_RS14525 (KNV92_14525) - 2975348..2975731 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  KNV92_RS14530 (KNV92_14530) comA 2975753..2976397 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  KNV92_RS14535 (KNV92_14535) comP 2976478..2978781 (-) 2304 WP_220181546.1 histidine kinase Regulator
  KNV92_RS14540 (KNV92_14540) comX 2978793..2978957 (-) 165 WP_007613432.1 competence pheromone ComX -
  KNV92_RS14545 (KNV92_14545) - 2978957..2979868 (-) 912 WP_031378407.1 polyprenyl synthetase family protein -
  KNV92_RS14550 (KNV92_14550) degQ 2980020..2980160 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  KNV92_RS14555 (KNV92_14555) - 2980625..2980966 (+) 342 WP_014305721.1 hypothetical protein -
  KNV92_RS14560 (KNV92_14560) - 2980973..2982193 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  KNV92_RS14565 (KNV92_14565) - 2982323..2983789 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  KNV92_RS14570 (KNV92_14570) - 2983807..2984358 (-) 552 WP_146275407.1 cysteine hydrolase family protein -
  KNV92_RS14575 (KNV92_14575) - 2984455..2984853 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=576057 KNV92_RS14550 WP_003152043.1 2980020..2980160(-) (degQ) [Bacillus velezensis strain WB]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=576057 KNV92_RS14550 WP_003152043.1 2980020..2980160(-) (degQ) [Bacillus velezensis strain WB]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891