Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   KNV92_RS11600 Genome accession   NZ_CP076514
Coordinates   2427625..2427939 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain WB     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2422625..2432939
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KNV92_RS11555 (KNV92_11555) sinI 2423308..2423481 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KNV92_RS11560 (KNV92_11560) sinR 2423515..2423850 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KNV92_RS11565 (KNV92_11565) tasA 2423898..2424683 (-) 786 WP_094247735.1 biofilm matrix protein TasA -
  KNV92_RS11570 (KNV92_11570) sipW 2424747..2425331 (-) 585 WP_012117977.1 signal peptidase I SipW -
  KNV92_RS11575 (KNV92_11575) tapA 2425303..2425974 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  KNV92_RS11580 (KNV92_11580) - 2426233..2426562 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  KNV92_RS11585 (KNV92_11585) - 2426602..2426781 (-) 180 WP_003153093.1 YqzE family protein -
  KNV92_RS11590 (KNV92_11590) comGG 2426838..2427215 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  KNV92_RS11595 (KNV92_11595) comGF 2427216..2427611 (-) 396 WP_094247733.1 competence type IV pilus minor pilin ComGF -
  KNV92_RS11600 (KNV92_11600) comGE 2427625..2427939 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  KNV92_RS11605 (KNV92_11605) comGD 2427923..2428360 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  KNV92_RS11610 (KNV92_11610) comGC 2428350..2428658 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  KNV92_RS11615 (KNV92_11615) comGB 2428663..2429700 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  KNV92_RS11620 (KNV92_11620) comGA 2429687..2430757 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  KNV92_RS11625 (KNV92_11625) - 2430949..2431899 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=576038 KNV92_RS11600 WP_015388003.1 2427625..2427939(-) (comGE) [Bacillus velezensis strain WB]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=576038 KNV92_RS11600 WP_015388003.1 2427625..2427939(-) (comGE) [Bacillus velezensis strain WB]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481