Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG53_RS00725 Genome accession   NZ_CP094139
Coordinates   149928..150053 (+) Length   41 a.a.
NCBI ID   WP_024117273.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe036     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 144928..155053
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG53_RS00700 (MPG53_00700) - 144988..147210 (+) 2223 WP_245060604.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG53_RS00705 (MPG53_00705) panD 147200..147550 (+) 351 WP_245060606.1 aspartate 1-decarboxylase -
  MPG53_RS00710 (MPG53_00710) - 147561..147854 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPG53_RS00715 (MPG53_00715) - 147854..148849 (+) 996 WP_245061248.1 PDZ domain-containing protein -
  MPG53_RS00720 (MPG53_00720) comB6 148857..149912 (+) 1056 WP_245061250.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG53_RS00725 (MPG53_00725) comB7 149928..150053 (+) 126 WP_024117273.1 hypothetical protein Machinery gene
  MPG53_RS00730 (MPG53_00730) comB8 150050..150787 (+) 738 WP_000660542.1 virB8 family protein Machinery gene
  MPG53_RS00735 (MPG53_00735) comB9 150787..151752 (+) 966 WP_245060608.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG53_RS00740 (MPG53_00740) comB10 151745..152881 (+) 1137 WP_245060610.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG53_RS00745 (MPG53_00745) - 152951..154363 (+) 1413 WP_245060612.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4752.75 Da        Isoelectric Point: 9.3278

>NTDB_id=576035 MPG53_RS00725 WP_024117273.1 149928..150053(+) (comB7) [Helicobacter pylori strain Hpfe036]
MRIFSVIMGLILFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=576035 MPG53_RS00725 WP_024117273.1 149928..150053(+) (comB7) [Helicobacter pylori strain Hpfe036]
ATGAGAATTTTTTCTGTCATTATGGGACTAATATTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829