Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KNV92_RS11555 Genome accession   NZ_CP076514
Coordinates   2423308..2423481 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain WB     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2418308..2428481
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KNV92_RS11540 (KNV92_11540) gcvT 2419125..2420225 (-) 1101 WP_094247736.1 glycine cleavage system aminomethyltransferase GcvT -
  KNV92_RS11545 (KNV92_11545) - 2420649..2422319 (+) 1671 WP_069013074.1 DEAD/DEAH box helicase -
  KNV92_RS11550 (KNV92_11550) - 2422337..2423131 (+) 795 WP_014305407.1 YqhG family protein -
  KNV92_RS11555 (KNV92_11555) sinI 2423308..2423481 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KNV92_RS11560 (KNV92_11560) sinR 2423515..2423850 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KNV92_RS11565 (KNV92_11565) tasA 2423898..2424683 (-) 786 WP_094247735.1 biofilm matrix protein TasA -
  KNV92_RS11570 (KNV92_11570) sipW 2424747..2425331 (-) 585 WP_012117977.1 signal peptidase I SipW -
  KNV92_RS11575 (KNV92_11575) tapA 2425303..2425974 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  KNV92_RS11580 (KNV92_11580) - 2426233..2426562 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  KNV92_RS11585 (KNV92_11585) - 2426602..2426781 (-) 180 WP_003153093.1 YqzE family protein -
  KNV92_RS11590 (KNV92_11590) comGG 2426838..2427215 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  KNV92_RS11595 (KNV92_11595) comGF 2427216..2427611 (-) 396 WP_094247733.1 competence type IV pilus minor pilin ComGF -
  KNV92_RS11600 (KNV92_11600) comGE 2427625..2427939 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  KNV92_RS11605 (KNV92_11605) comGD 2427923..2428360 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=576035 KNV92_RS11555 WP_003153105.1 2423308..2423481(+) (sinI) [Bacillus velezensis strain WB]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=576035 KNV92_RS11555 WP_003153105.1 2423308..2423481(+) (sinI) [Bacillus velezensis strain WB]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702