Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG06_RS00740 Genome accession   NZ_CP094126
Coordinates   157364..157489 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe056     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 152364..162489
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG06_RS00715 (MPG06_00715) - 152424..154646 (+) 2223 WP_245057930.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG06_RS00720 (MPG06_00720) panD 154636..154986 (+) 351 WP_245057931.1 aspartate 1-decarboxylase -
  MPG06_RS00725 (MPG06_00725) - 154997..155290 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPG06_RS00730 (MPG06_00730) - 155290..156285 (+) 996 WP_245058433.1 PDZ domain-containing protein -
  MPG06_RS00735 (MPG06_00735) comB6 156293..157348 (+) 1056 WP_245058435.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG06_RS00740 (MPG06_00740) comB7 157364..157489 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG06_RS00745 (MPG06_00745) comB8 157486..158229 (+) 744 WP_015645815.1 virB8 family protein Machinery gene
  MPG06_RS00750 (MPG06_00750) comB9 158229..159191 (+) 963 WP_245057932.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG06_RS00755 (MPG06_00755) comB10 159184..160320 (+) 1137 WP_245057933.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG06_RS00760 (MPG06_00760) - 160390..161802 (+) 1413 WP_245057934.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=575551 MPG06_RS00740 WP_001217874.1 157364..157489(+) (comB7) [Helicobacter pylori strain Hpfe056]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=575551 MPG06_RS00740 WP_001217874.1 157364..157489(+) (comB7) [Helicobacter pylori strain Hpfe056]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCCTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878