Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   KMZ16_RS12380 Genome accession   NZ_CP076445
Coordinates   2412157..2412531 (-) Length   124 a.a.
NCBI ID   WP_029726722.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain ps4100     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2407157..2417531
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KMZ16_RS12340 (KMZ16_12240) yqhG 2407489..2408283 (+) 795 WP_015714249.1 YqhG family protein -
  KMZ16_RS12345 (KMZ16_12245) sinI 2408466..2408639 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  KMZ16_RS12350 (KMZ16_12250) sinR 2408673..2409008 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KMZ16_RS12355 (KMZ16_12255) tasA 2409101..2409886 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  KMZ16_RS12360 (KMZ16_12260) sipW 2409950..2410522 (-) 573 WP_072692741.1 signal peptidase I SipW -
  KMZ16_RS12365 (KMZ16_12265) tapA 2410506..2411267 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  KMZ16_RS12370 (KMZ16_12270) yqzG 2411538..2411864 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KMZ16_RS12375 (KMZ16_12275) spoIITA 2411906..2412085 (-) 180 WP_029726723.1 YqzE family protein -
  KMZ16_RS12380 (KMZ16_12280) comGG 2412157..2412531 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  KMZ16_RS12385 (KMZ16_12285) comGF 2412532..2412915 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  KMZ16_RS12390 (KMZ16_12290) comGE 2412941..2413288 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  KMZ16_RS12395 (KMZ16_12295) comGD 2413272..2413703 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  KMZ16_RS12400 (KMZ16_12300) comGC 2413693..2413989 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  KMZ16_RS12405 (KMZ16_12305) comGB 2414003..2415040 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  KMZ16_RS12410 (KMZ16_12310) comGA 2415027..2416097 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  KMZ16_RS12415 (KMZ16_12315) - 2416310..2416507 (-) 198 WP_029726717.1 hypothetical protein -
  KMZ16_RS12420 (KMZ16_12320) corA 2416509..2417462 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14443.63 Da        Isoelectric Point: 7.8383

>NTDB_id=575345 KMZ16_RS12380 WP_029726722.1 2412157..2412531(-) (comGG) [Bacillus subtilis subsp. subtilis strain ps4100]
MYCTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSVRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=575345 KMZ16_RS12380 WP_029726722.1 2412157..2412531(-) (comGG) [Bacillus subtilis subsp. subtilis strain ps4100]
ATGTATTGTACAAGAGGGTTTATTTACCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGGTCCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952