Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KMZ16_RS12345 Genome accession   NZ_CP076445
Coordinates   2408466..2408639 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis strain ps4100     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2403466..2413639
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KMZ16_RS12330 (KMZ16_12230) gcvT 2404266..2405354 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  KMZ16_RS12335 (KMZ16_12235) hepAA 2405795..2407468 (+) 1674 WP_029726726.1 DEAD/DEAH box helicase -
  KMZ16_RS12340 (KMZ16_12240) yqhG 2407489..2408283 (+) 795 WP_015714249.1 YqhG family protein -
  KMZ16_RS12345 (KMZ16_12245) sinI 2408466..2408639 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  KMZ16_RS12350 (KMZ16_12250) sinR 2408673..2409008 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KMZ16_RS12355 (KMZ16_12255) tasA 2409101..2409886 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  KMZ16_RS12360 (KMZ16_12260) sipW 2409950..2410522 (-) 573 WP_072692741.1 signal peptidase I SipW -
  KMZ16_RS12365 (KMZ16_12265) tapA 2410506..2411267 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  KMZ16_RS12370 (KMZ16_12270) yqzG 2411538..2411864 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KMZ16_RS12375 (KMZ16_12275) spoIITA 2411906..2412085 (-) 180 WP_029726723.1 YqzE family protein -
  KMZ16_RS12380 (KMZ16_12280) comGG 2412157..2412531 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  KMZ16_RS12385 (KMZ16_12285) comGF 2412532..2412915 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  KMZ16_RS12390 (KMZ16_12290) comGE 2412941..2413288 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=575343 KMZ16_RS12345 WP_003230187.1 2408466..2408639(+) (sinI) [Bacillus subtilis subsp. subtilis strain ps4100]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=575343 KMZ16_RS12345 WP_003230187.1 2408466..2408639(+) (sinI) [Bacillus subtilis subsp. subtilis strain ps4100]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1