Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG34_RS00720 Genome accession   NZ_CP094117
Coordinates   151326..151439 (+) Length   37 a.a.
NCBI ID   WP_079298300.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe065     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 146326..156439
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG34_RS00695 (MPG34_00695) - 146388..148610 (+) 2223 WP_245106000.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG34_RS00700 (MPG34_00700) panD 148600..148950 (+) 351 WP_245078461.1 aspartate 1-decarboxylase -
  MPG34_RS00705 (MPG34_00705) - 148961..149254 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPG34_RS00710 (MPG34_00710) - 149254..150249 (+) 996 WP_245106354.1 PDZ domain-containing protein -
  MPG34_RS00715 (MPG34_00715) comB6 150255..151310 (+) 1056 WP_231246801.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG34_RS00720 (MPG34_00720) comB7 151326..151439 (+) 114 WP_079298300.1 comB7 lipoprotein Machinery gene
  MPG34_RS00725 (MPG34_00725) comB8 151436..152179 (+) 744 WP_245106001.1 virB8 family protein Machinery gene
  MPG34_RS00730 (MPG34_00730) comB9 152179..153144 (+) 966 WP_245106002.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG34_RS00735 (MPG34_00735) comB10 153137..154273 (+) 1137 WP_245106003.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG34_RS00740 (MPG34_00740) - 154343..155755 (+) 1413 WP_245106004.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4279.22 Da        Isoelectric Point: 9.5670

>NTDB_id=575312 MPG34_RS00720 WP_079298300.1 151326..151439(+) (comB7) [Helicobacter pylori strain Hpfe065]
MRIFFVIMGLILFGCTSKVHEMKKSPCTLHENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=575312 MPG34_RS00720 WP_079298300.1 151326..151439(+) (comB7) [Helicobacter pylori strain Hpfe065]
ATGAGAATTTTTTTTGTCATTATGGGACTAATATTGTTTGGTTGCACGAGCAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919