Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   I653_RS11715 Genome accession   NC_020832
Coordinates   2368451..2368624 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis str. BAB-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2363451..2373624
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I653_RS11700 (I653_11805) gcvT 2364250..2365338 (-) 1089 WP_015384081.1 glycine cleavage system aminomethyltransferase GcvT -
  I653_RS11705 (I653_11810) hepAA 2365780..2367453 (+) 1674 WP_015384082.1 SNF2-related protein -
  I653_RS11710 (I653_11815) yqhG 2367474..2368268 (+) 795 WP_003230200.1 YqhG family protein -
  I653_RS11715 (I653_11820) sinI 2368451..2368624 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  I653_RS11720 (I653_11825) sinR 2368658..2368993 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  I653_RS11725 (I653_11830) tasA 2369086..2369871 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  I653_RS11730 (I653_11835) sipW 2369935..2370507 (-) 573 WP_080030740.1 signal peptidase I SipW -
  I653_RS11735 (I653_11840) tapA 2370491..2371252 (-) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  I653_RS11740 (I653_11845) yqzG 2371522..2371848 (+) 327 WP_015384086.1 YqzG/YhdC family protein -
  I653_RS11745 (I653_11850) spoIITA 2371890..2372069 (-) 180 WP_003230176.1 YqzE family protein -
  I653_RS11750 (I653_11855) comGG 2372141..2372515 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  I653_RS11755 (I653_11860) comGF 2372516..2372899 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  I653_RS11760 (I653_11865) comGE 2372925..2373272 (-) 348 WP_015384088.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=57520 I653_RS11715 WP_003230187.1 2368451..2368624(+) (sinI) [Bacillus subtilis subsp. subtilis str. BAB-1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=57520 I653_RS11715 WP_003230187.1 2368451..2368624(+) (sinI) [Bacillus subtilis subsp. subtilis str. BAB-1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment