Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ZHX2020_RS01665 Genome accession   NZ_CP076409
Coordinates   284961..285344 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus sp. ZHX3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 279961..290344
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ZHX2020_RS01625 (ZHX2020_01625) sinI 280895..281068 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ZHX2020_RS01630 (ZHX2020_01630) sinR 281102..281437 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ZHX2020_RS01635 (ZHX2020_01635) tasA 281530..282315 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  ZHX2020_RS01640 (ZHX2020_01640) - 282379..282951 (-) 573 WP_003230181.1 signal peptidase I SipW -
  ZHX2020_RS01645 (ZHX2020_01645) tapA 282935..283696 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  ZHX2020_RS01650 (ZHX2020_01650) - 283968..284294 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ZHX2020_RS01655 (ZHX2020_01655) - 284336..284515 (-) 180 WP_014480252.1 YqzE family protein -
  ZHX2020_RS01660 (ZHX2020_01660) comGG 284586..284960 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ZHX2020_RS01665 (ZHX2020_01665) comGF 284961..285344 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  ZHX2020_RS01670 (ZHX2020_01670) comGE 285370..285717 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  ZHX2020_RS01675 (ZHX2020_01675) comGD 285701..286132 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  ZHX2020_RS01680 (ZHX2020_01680) comGC 286122..286418 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ZHX2020_RS01685 (ZHX2020_01685) comGB 286432..287469 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  ZHX2020_RS01690 (ZHX2020_01690) comGA 287456..288526 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ZHX2020_RS01695 (ZHX2020_01695) - 288738..288935 (-) 198 WP_014480259.1 CBS domain-containing protein -
  ZHX2020_RS01700 (ZHX2020_01700) corA 288937..289890 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=575102 ZHX2020_RS01665 WP_014480254.1 284961..285344(-) (comGF) [Bacillus sp. ZHX3]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=575102 ZHX2020_RS01665 WP_014480254.1 284961..285344(-) (comGF) [Bacillus sp. ZHX3]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984