Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ZHX2020_RS01625 Genome accession   NZ_CP076409
Coordinates   280895..281068 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. ZHX3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 275895..286068
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ZHX2020_RS01610 (ZHX2020_01610) gcvT 276694..277782 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  ZHX2020_RS01615 (ZHX2020_01615) - 278224..279897 (+) 1674 WP_014480248.1 SNF2-related protein -
  ZHX2020_RS01620 (ZHX2020_01620) - 279918..280712 (+) 795 WP_014480249.1 YqhG family protein -
  ZHX2020_RS01625 (ZHX2020_01625) sinI 280895..281068 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ZHX2020_RS01630 (ZHX2020_01630) sinR 281102..281437 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ZHX2020_RS01635 (ZHX2020_01635) tasA 281530..282315 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  ZHX2020_RS01640 (ZHX2020_01640) - 282379..282951 (-) 573 WP_003230181.1 signal peptidase I SipW -
  ZHX2020_RS01645 (ZHX2020_01645) tapA 282935..283696 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  ZHX2020_RS01650 (ZHX2020_01650) - 283968..284294 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ZHX2020_RS01655 (ZHX2020_01655) - 284336..284515 (-) 180 WP_014480252.1 YqzE family protein -
  ZHX2020_RS01660 (ZHX2020_01660) comGG 284586..284960 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ZHX2020_RS01665 (ZHX2020_01665) comGF 284961..285344 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  ZHX2020_RS01670 (ZHX2020_01670) comGE 285370..285717 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=575099 ZHX2020_RS01625 WP_003230187.1 280895..281068(+) (sinI) [Bacillus sp. ZHX3]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=575099 ZHX2020_RS01625 WP_003230187.1 280895..281068(+) (sinI) [Bacillus sp. ZHX3]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1