Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG41_RS00705 Genome accession   NZ_CP094109
Coordinates   151608..151733 (+) Length   41 a.a.
NCBI ID   WP_001217867.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe072     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 146608..156733
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG41_RS00680 (MPG41_00680) - 146667..148892 (+) 2226 WP_245067966.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG41_RS00685 (MPG41_00685) panD 148882..149232 (+) 351 WP_120843310.1 aspartate 1-decarboxylase -
  MPG41_RS00690 (MPG41_00690) - 149243..149536 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPG41_RS00695 (MPG41_00695) - 149536..150531 (+) 996 WP_245068533.1 PDZ domain-containing protein -
  MPG41_RS00700 (MPG41_00700) comB6 150537..151592 (+) 1056 WP_245067967.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG41_RS00705 (MPG41_00705) comB7 151608..151733 (+) 126 WP_001217867.1 hypothetical protein Machinery gene
  MPG41_RS00710 (MPG41_00710) comB8 151730..152473 (+) 744 WP_000660533.1 virB8 family protein Machinery gene
  MPG41_RS00715 (MPG41_00715) comB9 152473..153435 (+) 963 WP_245067968.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG41_RS00720 (MPG41_00720) comB10 153428..154564 (+) 1137 WP_245067969.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG41_RS00725 (MPG41_00725) - 154634..156049 (+) 1416 WP_245067970.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4830.88 Da        Isoelectric Point: 9.3278

>NTDB_id=575070 MPG41_RS00705 WP_001217867.1 151608..151733(+) (comB7) [Helicobacter pylori strain Hpfe072]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=575070 MPG41_RS00705 WP_001217867.1 151608..151733(+) (comB7) [Helicobacter pylori strain Hpfe072]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTATTTGGTTGCACTAGCAAGGTGCATGAGATGAAAAAAAGCCCCTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829